Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CX76

Protein Details
Accession Q0CX76    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-165SEDEKPAKKEEKKVEKPKAKAAEBasic
NLS Segment(s)
PositionSequence
36-40KAKSK
107-123KPAKKTEKAAPKKAAKK
148-162PAKKEEKKVEKPKAK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSKTKSVTKKGSEKPVAKTLSKVKDAGVTKASQSPKAKSKKVAREVMDSSSSSSSESEDEKPAKKQAVKKTEKKAESSSSESESDSSSDSDSDEEMEDASSESEEEKPAKKTEKAAPKKAAKKDESSSESSESSDSSDSESESEDEKPAKKEEKKVEKPKAKAAESSDSSESESESESSDSDSDEEEEEAPKKAAAKESSDSDSDSDSEPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.71
4 0.62
5 0.61
6 0.59
7 0.58
8 0.55
9 0.5
10 0.42
11 0.44
12 0.45
13 0.43
14 0.37
15 0.3
16 0.28
17 0.35
18 0.36
19 0.36
20 0.38
21 0.4
22 0.46
23 0.54
24 0.57
25 0.6
26 0.67
27 0.7
28 0.75
29 0.77
30 0.71
31 0.69
32 0.66
33 0.61
34 0.53
35 0.43
36 0.36
37 0.29
38 0.26
39 0.19
40 0.17
41 0.13
42 0.12
43 0.15
44 0.15
45 0.19
46 0.22
47 0.24
48 0.27
49 0.29
50 0.33
51 0.36
52 0.41
53 0.46
54 0.54
55 0.6
56 0.66
57 0.73
58 0.76
59 0.74
60 0.7
61 0.65
62 0.6
63 0.55
64 0.52
65 0.44
66 0.38
67 0.36
68 0.32
69 0.27
70 0.22
71 0.18
72 0.13
73 0.11
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.07
93 0.09
94 0.12
95 0.14
96 0.18
97 0.19
98 0.23
99 0.3
100 0.39
101 0.45
102 0.51
103 0.57
104 0.62
105 0.69
106 0.71
107 0.71
108 0.63
109 0.61
110 0.56
111 0.55
112 0.51
113 0.47
114 0.42
115 0.36
116 0.34
117 0.29
118 0.26
119 0.18
120 0.15
121 0.12
122 0.1
123 0.09
124 0.09
125 0.09
126 0.09
127 0.1
128 0.09
129 0.1
130 0.11
131 0.11
132 0.14
133 0.16
134 0.18
135 0.21
136 0.29
137 0.33
138 0.41
139 0.49
140 0.58
141 0.67
142 0.75
143 0.81
144 0.82
145 0.81
146 0.81
147 0.79
148 0.7
149 0.64
150 0.59
151 0.57
152 0.51
153 0.51
154 0.44
155 0.35
156 0.34
157 0.3
158 0.25
159 0.17
160 0.15
161 0.11
162 0.11
163 0.11
164 0.1
165 0.11
166 0.11
167 0.11
168 0.1
169 0.11
170 0.1
171 0.11
172 0.12
173 0.11
174 0.13
175 0.14
176 0.15
177 0.15
178 0.14
179 0.17
180 0.19
181 0.26
182 0.26
183 0.31
184 0.33
185 0.38
186 0.4
187 0.38
188 0.37
189 0.3
190 0.29
191 0.25
192 0.23