Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CCU6

Protein Details
Accession Q0CCU6   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-105AGSKRSTGPSRKRRTRAKNKKLAPTDPHydrophilic
NLS Segment(s)
PositionSequence
74-100HPKPPAGSKRSTGPSRKRRTRAKNKKL
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MWAVIRLVRQDFALSRVEKEIREKIRDTIKNPPPLPPLSPAPEATAPPADPALQTETLQKPSSGPPSSGPTAAHPKPPAGSKRSTGPSRKRRTRAKNKKLAPTDPVDAPIRTPLPGRSMLATASEAETPSKPPKQPSPRNWRDELIPATKQTLQPVSQIPDLNEPYWQFHFIELCLRQVETLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.28
4 0.3
5 0.29
6 0.34
7 0.41
8 0.41
9 0.45
10 0.45
11 0.46
12 0.54
13 0.58
14 0.55
15 0.57
16 0.58
17 0.62
18 0.61
19 0.61
20 0.55
21 0.52
22 0.51
23 0.45
24 0.42
25 0.37
26 0.39
27 0.34
28 0.33
29 0.32
30 0.3
31 0.27
32 0.24
33 0.19
34 0.17
35 0.17
36 0.13
37 0.11
38 0.13
39 0.14
40 0.13
41 0.13
42 0.18
43 0.2
44 0.24
45 0.24
46 0.22
47 0.2
48 0.23
49 0.29
50 0.25
51 0.24
52 0.23
53 0.27
54 0.29
55 0.28
56 0.25
57 0.22
58 0.28
59 0.28
60 0.3
61 0.26
62 0.25
63 0.26
64 0.31
65 0.32
66 0.28
67 0.29
68 0.27
69 0.32
70 0.38
71 0.42
72 0.45
73 0.51
74 0.57
75 0.65
76 0.72
77 0.74
78 0.78
79 0.83
80 0.86
81 0.87
82 0.87
83 0.87
84 0.85
85 0.86
86 0.81
87 0.73
88 0.65
89 0.58
90 0.5
91 0.4
92 0.37
93 0.29
94 0.23
95 0.21
96 0.2
97 0.16
98 0.14
99 0.15
100 0.13
101 0.14
102 0.16
103 0.16
104 0.15
105 0.15
106 0.14
107 0.15
108 0.14
109 0.11
110 0.11
111 0.1
112 0.09
113 0.1
114 0.11
115 0.13
116 0.18
117 0.23
118 0.25
119 0.29
120 0.39
121 0.49
122 0.59
123 0.66
124 0.71
125 0.75
126 0.79
127 0.78
128 0.7
129 0.62
130 0.59
131 0.54
132 0.49
133 0.42
134 0.36
135 0.36
136 0.37
137 0.36
138 0.33
139 0.31
140 0.26
141 0.27
142 0.31
143 0.32
144 0.33
145 0.33
146 0.31
147 0.34
148 0.36
149 0.33
150 0.32
151 0.29
152 0.29
153 0.29
154 0.3
155 0.23
156 0.22
157 0.23
158 0.2
159 0.27
160 0.24
161 0.25
162 0.24
163 0.23
164 0.21