Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0CSP3

Protein Details
Accession Q0CSP3   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-154MQFEARDKRAHNRNKRNIRKEKIEDMNDHydrophilic
NLS Segment(s)
PositionSequence
134-146KRAHNRNKRNIRK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0000160  P:phosphorelay signal transduction system  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
Amino Acid Sequences MLASGEVNDVTTVKDGEEAFDTVNARLDQGSVFDLIFMDIQIPNLNGLQRTRPIREMGVNCNSPGHTAEPVEVPGSKDISNEEGKRLVCIERLKGIIQNKYIEYICSREYRIYPSICCFLKHARKFMQFEARDKRAHNRNKRNIRKEKIEDMNDTQLGEMKRSDHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.13
4 0.15
5 0.15
6 0.14
7 0.16
8 0.17
9 0.14
10 0.19
11 0.17
12 0.15
13 0.14
14 0.14
15 0.11
16 0.12
17 0.12
18 0.09
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.12
35 0.14
36 0.19
37 0.23
38 0.26
39 0.27
40 0.28
41 0.29
42 0.34
43 0.35
44 0.35
45 0.37
46 0.35
47 0.33
48 0.31
49 0.29
50 0.23
51 0.21
52 0.16
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.09
65 0.09
66 0.12
67 0.16
68 0.15
69 0.16
70 0.17
71 0.17
72 0.17
73 0.18
74 0.15
75 0.15
76 0.16
77 0.16
78 0.16
79 0.18
80 0.18
81 0.21
82 0.24
83 0.24
84 0.24
85 0.25
86 0.22
87 0.24
88 0.23
89 0.2
90 0.18
91 0.16
92 0.17
93 0.17
94 0.18
95 0.17
96 0.18
97 0.23
98 0.26
99 0.26
100 0.25
101 0.26
102 0.31
103 0.29
104 0.29
105 0.26
106 0.31
107 0.39
108 0.42
109 0.46
110 0.49
111 0.56
112 0.58
113 0.62
114 0.63
115 0.56
116 0.59
117 0.61
118 0.58
119 0.53
120 0.52
121 0.55
122 0.55
123 0.62
124 0.65
125 0.67
126 0.74
127 0.82
128 0.9
129 0.92
130 0.93
131 0.91
132 0.91
133 0.87
134 0.86
135 0.84
136 0.79
137 0.74
138 0.69
139 0.68
140 0.58
141 0.5
142 0.4
143 0.36
144 0.31
145 0.27
146 0.22