Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XRU9

Protein Details
Accession F0XRU9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-56TTTIAKKKAGTKKVKKEPSASHydrophilic
NLS Segment(s)
PositionSequence
41-51KKKAGTKKVKK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000866  AhpC/TSA  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016209  F:antioxidant activity  
GO:0016491  F:oxidoreductase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00578  AhpC-TSA  
CDD cd03017  PRX_BCP  
Amino Acid Sequences MPVVLRKRKATESVPTPALKRQATSAVSKSASVAATTTIAKKKAGTKKVKKEPSASSLPTVGSAIDFETFGGYIENNEGEKTTLKALVDASKAGVVLFTYPKASTPGSSGLAIYGLSTDSPKANTTFKTNQNLPYPLLCDPNATLIKAIGLKKEPKGTTRGVFVVDKAGKVLVAESGSPDGTVDVVRKLVQSQTKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.51
4 0.49
5 0.51
6 0.42
7 0.37
8 0.33
9 0.35
10 0.36
11 0.39
12 0.37
13 0.35
14 0.35
15 0.34
16 0.31
17 0.27
18 0.24
19 0.19
20 0.16
21 0.11
22 0.12
23 0.13
24 0.17
25 0.19
26 0.2
27 0.2
28 0.23
29 0.31
30 0.39
31 0.48
32 0.54
33 0.6
34 0.7
35 0.8
36 0.86
37 0.81
38 0.78
39 0.75
40 0.7
41 0.67
42 0.57
43 0.49
44 0.41
45 0.36
46 0.3
47 0.24
48 0.18
49 0.1
50 0.09
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.09
71 0.09
72 0.1
73 0.11
74 0.13
75 0.13
76 0.12
77 0.11
78 0.09
79 0.1
80 0.08
81 0.07
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.07
89 0.09
90 0.09
91 0.09
92 0.1
93 0.13
94 0.13
95 0.13
96 0.13
97 0.11
98 0.11
99 0.1
100 0.08
101 0.05
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.07
108 0.08
109 0.1
110 0.12
111 0.13
112 0.2
113 0.27
114 0.32
115 0.38
116 0.4
117 0.44
118 0.47
119 0.48
120 0.42
121 0.37
122 0.33
123 0.27
124 0.28
125 0.22
126 0.18
127 0.17
128 0.22
129 0.22
130 0.19
131 0.18
132 0.15
133 0.16
134 0.19
135 0.2
136 0.17
137 0.21
138 0.25
139 0.28
140 0.36
141 0.37
142 0.35
143 0.39
144 0.41
145 0.39
146 0.39
147 0.36
148 0.32
149 0.31
150 0.28
151 0.32
152 0.28
153 0.26
154 0.22
155 0.21
156 0.17
157 0.16
158 0.16
159 0.09
160 0.09
161 0.09
162 0.1
163 0.12
164 0.12
165 0.12
166 0.11
167 0.09
168 0.09
169 0.1
170 0.1
171 0.1
172 0.11
173 0.12
174 0.13
175 0.15
176 0.21