Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XG43

Protein Details
Accession F0XG43    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-49VLRLRGGAKKRKKKVYTTPKKIKHKHKKTKLAVLKYYBasic
NLS Segment(s)
PositionSequence
16-42LRGGAKKRKKKVYTTPKKIKHKHKKTK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MIRSEKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKHKKTKLAVLKYYKVDSDGKIERLRRECPNETCGAGVFMAAMQDRQYCGRCHLTYVFGEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.25
4 0.25
5 0.31
6 0.38
7 0.46
8 0.55
9 0.62
10 0.71
11 0.75
12 0.8
13 0.83
14 0.85
15 0.85
16 0.86
17 0.87
18 0.87
19 0.91
20 0.91
21 0.91
22 0.91
23 0.91
24 0.91
25 0.91
26 0.92
27 0.88
28 0.89
29 0.87
30 0.83
31 0.79
32 0.74
33 0.67
34 0.59
35 0.53
36 0.42
37 0.36
38 0.3
39 0.23
40 0.23
41 0.21
42 0.23
43 0.27
44 0.3
45 0.33
46 0.35
47 0.39
48 0.4
49 0.44
50 0.47
51 0.46
52 0.48
53 0.44
54 0.41
55 0.36
56 0.3
57 0.23
58 0.17
59 0.13
60 0.08
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.09
68 0.13
69 0.15
70 0.16
71 0.21
72 0.29
73 0.29
74 0.32
75 0.34
76 0.34
77 0.35