Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XUE8

Protein Details
Accession F0XUE8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
40-62EMVFACKKCKKCFRKDAREFEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHVLNAQVSIRSPCCHKWFDCVECHREQEDHPLMQRFEMVFACKKCKKCFRKDAREFEDSDEYCPHCDNHYVLDAITPKAAITVEGGDVRIDNRMIKDDRVKAQQFRDIFDPDLDADKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.36
4 0.37
5 0.36
6 0.4
7 0.45
8 0.48
9 0.53
10 0.52
11 0.52
12 0.5
13 0.52
14 0.46
15 0.4
16 0.36
17 0.37
18 0.36
19 0.33
20 0.33
21 0.34
22 0.32
23 0.31
24 0.32
25 0.22
26 0.19
27 0.17
28 0.17
29 0.18
30 0.2
31 0.27
32 0.3
33 0.35
34 0.41
35 0.51
36 0.57
37 0.62
38 0.71
39 0.74
40 0.81
41 0.85
42 0.88
43 0.83
44 0.77
45 0.68
46 0.6
47 0.56
48 0.45
49 0.37
50 0.29
51 0.23
52 0.21
53 0.2
54 0.17
55 0.11
56 0.13
57 0.11
58 0.12
59 0.13
60 0.12
61 0.12
62 0.14
63 0.14
64 0.13
65 0.12
66 0.1
67 0.08
68 0.09
69 0.09
70 0.06
71 0.06
72 0.06
73 0.08
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.1
83 0.16
84 0.18
85 0.22
86 0.29
87 0.34
88 0.39
89 0.46
90 0.5
91 0.5
92 0.53
93 0.56
94 0.5
95 0.47
96 0.46
97 0.4
98 0.37
99 0.32
100 0.29
101 0.23
102 0.26