Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XJV6

Protein Details
Accession F0XJV6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-100TPSPSNKPRRSPRIGTKKKTHydrophilic
NLS Segment(s)
PositionSequence
86-126NKPRRSPRIGTKKKTDGPLPKPCKKPTARAKQTKEKALRRR
Subcellular Location(s) nucl 14, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MPGTPVKTSPSLSLLGTAEKSTWMAWTSSSDGGKVEPNSLASILAPLSPGCCVSSNIPAIPMGASFEAFANSNPPWPTTPTPSPSNKPRRSPRIGTKKKTDGPLPKPCKKPTARAKQTKEKALRRRVDVLQEKNKTLRKQKWDLENEITVLKAKIMTDEEEMRSVDDMEKRLDHSRRYIRALKMQVRALGGYVIDVSDEDGESSNDSGDGELPASFPRAAANPSEFSLPALRAKRSGRQKTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.19
5 0.16
6 0.15
7 0.16
8 0.13
9 0.13
10 0.12
11 0.11
12 0.12
13 0.15
14 0.18
15 0.22
16 0.22
17 0.2
18 0.19
19 0.2
20 0.24
21 0.22
22 0.2
23 0.16
24 0.17
25 0.18
26 0.18
27 0.17
28 0.11
29 0.11
30 0.1
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.18
42 0.2
43 0.2
44 0.2
45 0.18
46 0.18
47 0.16
48 0.13
49 0.09
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.13
60 0.13
61 0.14
62 0.15
63 0.2
64 0.23
65 0.27
66 0.32
67 0.32
68 0.38
69 0.42
70 0.47
71 0.52
72 0.6
73 0.6
74 0.65
75 0.7
76 0.73
77 0.75
78 0.77
79 0.78
80 0.78
81 0.81
82 0.78
83 0.77
84 0.77
85 0.73
86 0.69
87 0.66
88 0.64
89 0.63
90 0.67
91 0.67
92 0.67
93 0.69
94 0.67
95 0.69
96 0.62
97 0.64
98 0.64
99 0.66
100 0.68
101 0.72
102 0.77
103 0.78
104 0.8
105 0.78
106 0.77
107 0.74
108 0.74
109 0.73
110 0.7
111 0.64
112 0.64
113 0.57
114 0.57
115 0.56
116 0.55
117 0.55
118 0.53
119 0.5
120 0.5
121 0.54
122 0.5
123 0.51
124 0.51
125 0.5
126 0.55
127 0.6
128 0.64
129 0.64
130 0.64
131 0.59
132 0.52
133 0.45
134 0.37
135 0.31
136 0.22
137 0.16
138 0.11
139 0.08
140 0.07
141 0.08
142 0.09
143 0.11
144 0.13
145 0.16
146 0.17
147 0.17
148 0.17
149 0.16
150 0.15
151 0.14
152 0.14
153 0.14
154 0.15
155 0.15
156 0.16
157 0.18
158 0.25
159 0.28
160 0.28
161 0.35
162 0.42
163 0.45
164 0.51
165 0.55
166 0.53
167 0.57
168 0.64
169 0.62
170 0.59
171 0.56
172 0.52
173 0.46
174 0.42
175 0.33
176 0.25
177 0.18
178 0.12
179 0.1
180 0.07
181 0.05
182 0.05
183 0.06
184 0.05
185 0.06
186 0.06
187 0.06
188 0.07
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.08
201 0.11
202 0.1
203 0.09
204 0.11
205 0.12
206 0.14
207 0.17
208 0.21
209 0.2
210 0.22
211 0.24
212 0.22
213 0.22
214 0.24
215 0.22
216 0.25
217 0.28
218 0.29
219 0.33
220 0.38
221 0.45
222 0.53
223 0.62