Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XLY7

Protein Details
Accession F0XLY7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77TGRPRGRPPKDPSQKKKSATBasic
NLS Segment(s)
PositionSequence
29-130AKPASGKGSGKRGRPPMDPTQRKTQAYVPTGRPRGRPPKDPSQKKKSATAAEPTSKAASGSGRGRGRPPGSKSKKAAALADPKPAASATLAKTPGKRGRKSK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MPRQSTAATGTDGVPHTTRPAQESSAKVAKPASGKGSGKRGRPPMDPTQRKTQAYVPTGRPRGRPPKDPSQKKKSATAAEPTSKAASGSGRGRGRPPGSKSKKAAALADPKPAASATLAKTPGKRGRKSKATLAAEAAAAEAALEATEAAGVTGSSPLEGDYAEEEEQEDEEDESSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.2
4 0.23
5 0.24
6 0.23
7 0.25
8 0.27
9 0.31
10 0.34
11 0.37
12 0.4
13 0.38
14 0.36
15 0.34
16 0.33
17 0.31
18 0.31
19 0.28
20 0.29
21 0.32
22 0.36
23 0.45
24 0.47
25 0.49
26 0.54
27 0.57
28 0.54
29 0.56
30 0.58
31 0.58
32 0.64
33 0.67
34 0.64
35 0.67
36 0.69
37 0.66
38 0.62
39 0.57
40 0.54
41 0.51
42 0.52
43 0.48
44 0.5
45 0.55
46 0.56
47 0.52
48 0.53
49 0.59
50 0.58
51 0.6
52 0.59
53 0.63
54 0.71
55 0.79
56 0.79
57 0.78
58 0.81
59 0.75
60 0.74
61 0.69
62 0.64
63 0.56
64 0.54
65 0.49
66 0.44
67 0.42
68 0.36
69 0.3
70 0.25
71 0.22
72 0.15
73 0.11
74 0.11
75 0.12
76 0.18
77 0.19
78 0.2
79 0.21
80 0.26
81 0.28
82 0.31
83 0.34
84 0.39
85 0.45
86 0.51
87 0.53
88 0.53
89 0.55
90 0.51
91 0.48
92 0.42
93 0.44
94 0.39
95 0.41
96 0.36
97 0.3
98 0.29
99 0.26
100 0.21
101 0.13
102 0.15
103 0.12
104 0.17
105 0.19
106 0.21
107 0.22
108 0.29
109 0.37
110 0.42
111 0.47
112 0.5
113 0.58
114 0.65
115 0.69
116 0.69
117 0.71
118 0.66
119 0.61
120 0.55
121 0.46
122 0.37
123 0.32
124 0.24
125 0.13
126 0.09
127 0.07
128 0.04
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.08
149 0.11
150 0.11
151 0.11
152 0.11
153 0.12
154 0.12
155 0.12
156 0.11
157 0.09