Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V3F9

Protein Details
Accession Q0V3F9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKSSSKVPGRPAKRAKKSNITIIPEHydrophilic
NLS Segment(s)
PositionSequence
10-18GRPAKRAKK
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
KEGG pno:SNOG_01455  -  
Amino Acid Sequences MSKSSSKVPGRPAKRAKKSNITIIPEQLSNSGLGFLDLPAGKSKTNREGTLLTICISELRNWVYDYVAHDDDPDDRPPALHYHPHAGPQTHTTSRAPLRQGFALTQTCRLIRYEYLPIYQSHARVACSFQSLRACCIDKDGSGPQLVLPLGKTSVEYRMKVRAPDENGRLGRLVYDTEETDLLAIMSAVQRTPNLHLEFNPSIWTDIGAVLNIQDNPTWSKALDEKIQRIRLLPESVHFRPVVAFEVKEGYAEAWMARKCSTLIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.84
4 0.85
5 0.84
6 0.84
7 0.82
8 0.78
9 0.71
10 0.67
11 0.6
12 0.5
13 0.45
14 0.35
15 0.27
16 0.21
17 0.17
18 0.13
19 0.1
20 0.09
21 0.09
22 0.07
23 0.11
24 0.11
25 0.12
26 0.15
27 0.16
28 0.18
29 0.21
30 0.27
31 0.32
32 0.37
33 0.37
34 0.37
35 0.37
36 0.39
37 0.4
38 0.35
39 0.26
40 0.21
41 0.2
42 0.18
43 0.17
44 0.15
45 0.13
46 0.14
47 0.15
48 0.16
49 0.16
50 0.15
51 0.15
52 0.17
53 0.2
54 0.19
55 0.17
56 0.17
57 0.17
58 0.19
59 0.2
60 0.19
61 0.15
62 0.14
63 0.14
64 0.15
65 0.19
66 0.19
67 0.21
68 0.22
69 0.26
70 0.27
71 0.31
72 0.33
73 0.3
74 0.28
75 0.27
76 0.31
77 0.26
78 0.28
79 0.24
80 0.27
81 0.3
82 0.33
83 0.32
84 0.3
85 0.31
86 0.29
87 0.3
88 0.25
89 0.25
90 0.25
91 0.23
92 0.22
93 0.21
94 0.2
95 0.2
96 0.2
97 0.18
98 0.14
99 0.17
100 0.19
101 0.19
102 0.2
103 0.21
104 0.2
105 0.22
106 0.23
107 0.2
108 0.17
109 0.17
110 0.16
111 0.16
112 0.17
113 0.13
114 0.15
115 0.14
116 0.14
117 0.19
118 0.18
119 0.19
120 0.2
121 0.21
122 0.17
123 0.21
124 0.19
125 0.14
126 0.17
127 0.17
128 0.15
129 0.14
130 0.14
131 0.11
132 0.12
133 0.11
134 0.08
135 0.07
136 0.07
137 0.07
138 0.07
139 0.08
140 0.07
141 0.15
142 0.18
143 0.19
144 0.21
145 0.27
146 0.28
147 0.3
148 0.3
149 0.28
150 0.31
151 0.37
152 0.37
153 0.38
154 0.37
155 0.36
156 0.35
157 0.29
158 0.23
159 0.17
160 0.15
161 0.09
162 0.1
163 0.1
164 0.11
165 0.11
166 0.1
167 0.09
168 0.08
169 0.06
170 0.05
171 0.04
172 0.04
173 0.05
174 0.05
175 0.05
176 0.06
177 0.07
178 0.08
179 0.12
180 0.19
181 0.2
182 0.21
183 0.22
184 0.29
185 0.3
186 0.29
187 0.27
188 0.21
189 0.19
190 0.18
191 0.18
192 0.11
193 0.11
194 0.11
195 0.09
196 0.08
197 0.08
198 0.1
199 0.1
200 0.09
201 0.08
202 0.1
203 0.13
204 0.15
205 0.15
206 0.13
207 0.16
208 0.19
209 0.24
210 0.29
211 0.32
212 0.39
213 0.47
214 0.52
215 0.49
216 0.48
217 0.47
218 0.46
219 0.44
220 0.36
221 0.33
222 0.37
223 0.38
224 0.39
225 0.35
226 0.3
227 0.27
228 0.27
229 0.26
230 0.21
231 0.19
232 0.17
233 0.21
234 0.2
235 0.19
236 0.18
237 0.14
238 0.12
239 0.12
240 0.12
241 0.15
242 0.16
243 0.18
244 0.18
245 0.19