Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XA59

Protein Details
Accession F0XA59    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
208-237REEPLLKQVRTQQKRRNRVQPRRRRECGQMHydrophilic
NLS Segment(s)
PositionSequence
221-231KRRNRVQPRRR
Subcellular Location(s) cyto 11, cyto_nucl 9, nucl 5, mito 4, pero 3, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MYADTDAERADSSVFCTCTGSYVLDRAQECRTLSPMGARLVGVCPTEDGNAVNVLASLAKSTPSLHDTGSALCTAAPLSALSALSVLLGRAVQGVGCAGLVQLLFHGRLLSRKNIGLLFYINLPPGRSCFRDAERAALGMRASAAHTEKTKRVQTRRYKILTTCQCIAAAAFLDNVDIAKPRTGRREEIQDEHATHGIYLAVWFRRWREEPLLKQVRTQQKRRNRVQPRRRRECGQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.17
5 0.18
6 0.2
7 0.19
8 0.16
9 0.19
10 0.2
11 0.23
12 0.24
13 0.25
14 0.26
15 0.27
16 0.27
17 0.26
18 0.27
19 0.23
20 0.23
21 0.25
22 0.27
23 0.24
24 0.24
25 0.21
26 0.2
27 0.19
28 0.21
29 0.17
30 0.13
31 0.12
32 0.12
33 0.13
34 0.12
35 0.11
36 0.1
37 0.1
38 0.1
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.1
50 0.12
51 0.13
52 0.12
53 0.14
54 0.15
55 0.15
56 0.15
57 0.13
58 0.11
59 0.09
60 0.09
61 0.07
62 0.06
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.04
74 0.03
75 0.03
76 0.03
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.09
96 0.11
97 0.14
98 0.15
99 0.15
100 0.17
101 0.17
102 0.17
103 0.14
104 0.13
105 0.11
106 0.1
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.1
113 0.12
114 0.13
115 0.15
116 0.18
117 0.2
118 0.27
119 0.28
120 0.29
121 0.27
122 0.26
123 0.23
124 0.2
125 0.18
126 0.1
127 0.1
128 0.06
129 0.06
130 0.07
131 0.09
132 0.09
133 0.12
134 0.16
135 0.19
136 0.25
137 0.31
138 0.37
139 0.44
140 0.52
141 0.6
142 0.66
143 0.72
144 0.71
145 0.68
146 0.63
147 0.66
148 0.64
149 0.59
150 0.51
151 0.42
152 0.38
153 0.34
154 0.31
155 0.21
156 0.14
157 0.09
158 0.07
159 0.06
160 0.06
161 0.06
162 0.06
163 0.05
164 0.06
165 0.07
166 0.1
167 0.13
168 0.17
169 0.25
170 0.29
171 0.34
172 0.38
173 0.47
174 0.48
175 0.5
176 0.52
177 0.48
178 0.46
179 0.44
180 0.4
181 0.3
182 0.24
183 0.2
184 0.15
185 0.1
186 0.1
187 0.11
188 0.12
189 0.14
190 0.16
191 0.18
192 0.26
193 0.28
194 0.34
195 0.4
196 0.48
197 0.52
198 0.62
199 0.69
200 0.62
201 0.64
202 0.67
203 0.68
204 0.68
205 0.71
206 0.7
207 0.71
208 0.81
209 0.86
210 0.88
211 0.88
212 0.9
213 0.92
214 0.93
215 0.93
216 0.93
217 0.91