Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XDF8

Protein Details
Accession F0XDF8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
192-241EANVERKRIKKHGKTRPQAMVAQSETRRSTRTRASNKRRRVAKPAKAPASHydrophilic
NLS Segment(s)
PositionSequence
197-238RKRIKKHGKTRPQAMVAQSETRRSTRTRASNKRRRVAKPAKA
Subcellular Location(s) mito 15, cyto 4, extr 4, nucl 3
Family & Domain DBs
Amino Acid Sequences MSACTEIRLGRQRFASRNLQLSVTVTAIAELSWRTAGSEVLGPYASAERVAQLVRAGRLWVGCGGSAFGLVVYPTLQRQHILLRGNSKDSESDSTYSAGWLAKAVLSWPAWDRLGLVVRLDGNDKDGTGRWQSGDRRWDAGRLFFSVTHPSSPGGLCAPAGVPQAQFRRVVCHLNFALHLDGPELGISSTAEANVERKRIKKHGKTRPQAMVAQSETRRSTRTRASNKRRRVAKPAKAPASTIFGDCELRTKASTLIEASLYVLVGIKGRVLGVRSIEPFYVKPLPSLISIAPAVWNYRHFQFSYHLYAPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.56
4 0.59
5 0.56
6 0.5
7 0.43
8 0.4
9 0.36
10 0.26
11 0.21
12 0.14
13 0.13
14 0.11
15 0.1
16 0.09
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.1
25 0.14
26 0.12
27 0.13
28 0.13
29 0.12
30 0.13
31 0.14
32 0.13
33 0.09
34 0.09
35 0.08
36 0.1
37 0.11
38 0.1
39 0.11
40 0.14
41 0.15
42 0.16
43 0.15
44 0.15
45 0.15
46 0.15
47 0.14
48 0.12
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.07
55 0.05
56 0.05
57 0.04
58 0.04
59 0.05
60 0.05
61 0.07
62 0.09
63 0.1
64 0.11
65 0.12
66 0.16
67 0.2
68 0.24
69 0.26
70 0.31
71 0.33
72 0.36
73 0.35
74 0.32
75 0.28
76 0.26
77 0.28
78 0.23
79 0.22
80 0.2
81 0.2
82 0.19
83 0.18
84 0.16
85 0.12
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.08
93 0.08
94 0.09
95 0.1
96 0.12
97 0.12
98 0.12
99 0.12
100 0.12
101 0.15
102 0.14
103 0.12
104 0.11
105 0.11
106 0.12
107 0.13
108 0.1
109 0.1
110 0.1
111 0.1
112 0.1
113 0.1
114 0.12
115 0.13
116 0.13
117 0.12
118 0.17
119 0.2
120 0.24
121 0.29
122 0.28
123 0.3
124 0.29
125 0.32
126 0.28
127 0.28
128 0.24
129 0.2
130 0.2
131 0.17
132 0.18
133 0.19
134 0.19
135 0.16
136 0.15
137 0.14
138 0.14
139 0.13
140 0.13
141 0.08
142 0.08
143 0.07
144 0.06
145 0.06
146 0.07
147 0.08
148 0.07
149 0.07
150 0.12
151 0.14
152 0.15
153 0.17
154 0.15
155 0.19
156 0.21
157 0.26
158 0.22
159 0.26
160 0.25
161 0.24
162 0.24
163 0.21
164 0.2
165 0.14
166 0.13
167 0.08
168 0.08
169 0.07
170 0.06
171 0.05
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.04
178 0.05
179 0.05
180 0.08
181 0.1
182 0.15
183 0.17
184 0.21
185 0.27
186 0.37
187 0.47
188 0.54
189 0.63
190 0.69
191 0.77
192 0.81
193 0.84
194 0.82
195 0.75
196 0.69
197 0.6
198 0.55
199 0.46
200 0.45
201 0.38
202 0.34
203 0.32
204 0.3
205 0.3
206 0.27
207 0.3
208 0.33
209 0.42
210 0.49
211 0.58
212 0.68
213 0.75
214 0.83
215 0.86
216 0.86
217 0.82
218 0.82
219 0.81
220 0.8
221 0.81
222 0.81
223 0.79
224 0.71
225 0.67
226 0.59
227 0.53
228 0.44
229 0.34
230 0.25
231 0.2
232 0.2
233 0.19
234 0.2
235 0.16
236 0.17
237 0.17
238 0.17
239 0.18
240 0.18
241 0.2
242 0.17
243 0.17
244 0.16
245 0.15
246 0.15
247 0.12
248 0.11
249 0.09
250 0.08
251 0.07
252 0.07
253 0.07
254 0.06
255 0.06
256 0.07
257 0.09
258 0.1
259 0.12
260 0.14
261 0.19
262 0.21
263 0.22
264 0.23
265 0.24
266 0.23
267 0.26
268 0.3
269 0.26
270 0.25
271 0.25
272 0.26
273 0.25
274 0.27
275 0.21
276 0.18
277 0.18
278 0.18
279 0.17
280 0.17
281 0.18
282 0.18
283 0.2
284 0.2
285 0.23
286 0.27
287 0.25
288 0.27
289 0.3
290 0.33
291 0.39