Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XMK2

Protein Details
Accession F0XMK2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
207-232MKRARNTLAARKSRQRKQERLEELEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MVLEGTLDPTTTITSSLRTFAYIYDVDLTDFPAGYDSAVFSSPAVGVYDLHAGGSSNSSHVGTVSPHDLFLHDSFMSAPNSTALTSLTSPSDYNESPYVDSYDVSPNFGTGDAEAVSGQDAAWFPLFDQINNAVAGAAAADDKISPESDFADLSEDKVDSSSRRGSGHTRSASSSTKHSSVSGVNSRRRDKPLAPIVVEDPSDTVAMKRARNTLAARKSRQRKQERLEELEEVIAKLTAERDHWKKVALNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.16
5 0.16
6 0.16
7 0.15
8 0.19
9 0.16
10 0.16
11 0.17
12 0.17
13 0.16
14 0.16
15 0.17
16 0.13
17 0.12
18 0.11
19 0.09
20 0.09
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.09
27 0.07
28 0.08
29 0.08
30 0.08
31 0.09
32 0.08
33 0.07
34 0.09
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.1
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.08
50 0.1
51 0.13
52 0.12
53 0.12
54 0.12
55 0.13
56 0.15
57 0.14
58 0.15
59 0.12
60 0.12
61 0.12
62 0.15
63 0.15
64 0.13
65 0.12
66 0.1
67 0.1
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.1
74 0.09
75 0.1
76 0.1
77 0.11
78 0.14
79 0.12
80 0.14
81 0.15
82 0.16
83 0.15
84 0.16
85 0.17
86 0.13
87 0.13
88 0.12
89 0.17
90 0.16
91 0.16
92 0.15
93 0.14
94 0.14
95 0.14
96 0.12
97 0.05
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.05
112 0.1
113 0.11
114 0.09
115 0.11
116 0.12
117 0.13
118 0.13
119 0.12
120 0.07
121 0.07
122 0.07
123 0.05
124 0.04
125 0.02
126 0.02
127 0.02
128 0.02
129 0.03
130 0.04
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.07
138 0.1
139 0.09
140 0.1
141 0.11
142 0.1
143 0.09
144 0.09
145 0.1
146 0.08
147 0.12
148 0.14
149 0.15
150 0.17
151 0.19
152 0.23
153 0.29
154 0.36
155 0.36
156 0.34
157 0.34
158 0.37
159 0.39
160 0.36
161 0.34
162 0.3
163 0.29
164 0.28
165 0.26
166 0.24
167 0.23
168 0.28
169 0.32
170 0.35
171 0.4
172 0.47
173 0.51
174 0.55
175 0.57
176 0.57
177 0.51
178 0.53
179 0.56
180 0.54
181 0.51
182 0.47
183 0.43
184 0.4
185 0.37
186 0.27
187 0.19
188 0.14
189 0.13
190 0.11
191 0.09
192 0.14
193 0.18
194 0.21
195 0.24
196 0.27
197 0.29
198 0.35
199 0.41
200 0.44
201 0.5
202 0.56
203 0.59
204 0.65
205 0.73
206 0.75
207 0.8
208 0.81
209 0.81
210 0.81
211 0.84
212 0.83
213 0.8
214 0.77
215 0.68
216 0.59
217 0.52
218 0.44
219 0.33
220 0.25
221 0.18
222 0.13
223 0.12
224 0.13
225 0.11
226 0.14
227 0.23
228 0.28
229 0.35
230 0.36
231 0.4