Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0X825

Protein Details
Accession F0X825    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-49AWEVSWRDRGRRRERSRRTQDDRDLDBasic
NLS Segment(s)
PositionSequence
34-38RRRER
Subcellular Location(s) nucl 12, mito 5, cyto 3.5, cysk 3, cyto_pero 3, pero 1.5
Family & Domain DBs
Amino Acid Sequences MQGMQGGSGVGTQPGRILVDDVDAWEVSWRDRGRRRERSRRTQDDRDLDAEPDEPDGVAPGSGRGGHGVDWLSRGEMDGGSWVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.1
5 0.08
6 0.1
7 0.1
8 0.1
9 0.1
10 0.09
11 0.09
12 0.1
13 0.1
14 0.08
15 0.15
16 0.15
17 0.21
18 0.29
19 0.39
20 0.47
21 0.58
22 0.68
23 0.73
24 0.82
25 0.86
26 0.89
27 0.89
28 0.87
29 0.84
30 0.82
31 0.76
32 0.69
33 0.61
34 0.51
35 0.41
36 0.34
37 0.26
38 0.19
39 0.13
40 0.11
41 0.08
42 0.06
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.1
55 0.11
56 0.1
57 0.12
58 0.12
59 0.12
60 0.11
61 0.12
62 0.11
63 0.09
64 0.09