Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XDN9

Protein Details
Accession F0XDN9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNIPKTRKTYCKGKECRKHTQHKVTQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTYCKGKECRKHTQHKVTQYKTGKASLFAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKIVLRLECTSCKAKKQLPLKRTKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.85
10 0.86
11 0.89
12 0.81
13 0.81
14 0.76
15 0.71
16 0.62
17 0.59
18 0.49
19 0.41
20 0.39
21 0.37
22 0.38
23 0.36
24 0.41
25 0.43
26 0.47
27 0.51
28 0.55
29 0.53
30 0.56
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.68
57 0.63
58 0.6
59 0.59
60 0.53
61 0.48
62 0.47
63 0.42
64 0.4
65 0.41
66 0.42
67 0.44
68 0.53
69 0.58
70 0.61
71 0.7
72 0.73
73 0.77
74 0.79
75 0.76
76 0.73
77 0.66
78 0.62
79 0.62
80 0.62
81 0.61
82 0.59
83 0.54
84 0.47
85 0.46
86 0.41