Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XCX9

Protein Details
Accession F0XCX9    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-34SSNGDSSKPRRKPLTQKQKDFLSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11.5, cyto 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009078  Ferritin-like_SF  
IPR011566  Ubq_synth_Coq7  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0008682  F:3-demethoxyubiquinol 3-hydroxylase activity  
GO:0046872  F:metal ion binding  
GO:0016709  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF03232  COQ7  
CDD cd01042  DMQH  
Amino Acid Sequences MPPVPPPVSISSNGDSSKPRRKPLTQKQKDFLSSALRVNQTGELAATLIYAAQMPLLTRTHPHLRPLMKHMYNQEKGHLDTFNKLITKHRVRPTALYPFWYAAATGLGWSTAFLGREAAMACTEAVETEIGTHYNGQIRELLEMTSEWTAEGYDVGPELTDLIETLRRIRDEELEHLDHAVENDAKKAEPHWLLTGIIRAGCRGAIWVSERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.38
4 0.46
5 0.47
6 0.52
7 0.55
8 0.64
9 0.73
10 0.78
11 0.82
12 0.82
13 0.85
14 0.84
15 0.84
16 0.77
17 0.68
18 0.6
19 0.55
20 0.48
21 0.42
22 0.41
23 0.35
24 0.32
25 0.32
26 0.29
27 0.22
28 0.19
29 0.15
30 0.1
31 0.09
32 0.08
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.04
41 0.04
42 0.07
43 0.08
44 0.08
45 0.1
46 0.15
47 0.23
48 0.25
49 0.29
50 0.33
51 0.37
52 0.4
53 0.45
54 0.49
55 0.43
56 0.44
57 0.48
58 0.51
59 0.52
60 0.49
61 0.47
62 0.4
63 0.39
64 0.38
65 0.33
66 0.25
67 0.21
68 0.22
69 0.2
70 0.18
71 0.18
72 0.21
73 0.28
74 0.34
75 0.4
76 0.45
77 0.48
78 0.49
79 0.52
80 0.52
81 0.53
82 0.45
83 0.4
84 0.34
85 0.29
86 0.28
87 0.24
88 0.19
89 0.09
90 0.09
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.04
112 0.05
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.1
122 0.11
123 0.11
124 0.13
125 0.13
126 0.14
127 0.14
128 0.13
129 0.09
130 0.09
131 0.1
132 0.08
133 0.08
134 0.07
135 0.06
136 0.06
137 0.06
138 0.06
139 0.04
140 0.04
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.08
151 0.09
152 0.12
153 0.15
154 0.16
155 0.18
156 0.2
157 0.24
158 0.25
159 0.3
160 0.34
161 0.33
162 0.32
163 0.31
164 0.29
165 0.24
166 0.21
167 0.18
168 0.14
169 0.12
170 0.15
171 0.15
172 0.15
173 0.16
174 0.16
175 0.2
176 0.21
177 0.24
178 0.24
179 0.25
180 0.26
181 0.27
182 0.29
183 0.23
184 0.22
185 0.19
186 0.17
187 0.16
188 0.15
189 0.13
190 0.12
191 0.11
192 0.13