Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UKV2

Protein Details
Accession Q0UKV2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
465-486QSKWTVKMAKPRTKTRSSLRIGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 4, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002656  Acyl_transf_3_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
GO:0000271  P:polysaccharide biosynthetic process  
KEGG pno:SNOG_07612  -  
Pfam View protein in Pfam  
PF01757  Acyl_transf_3  
Amino Acid Sequences MARQPVMIPLKFEKQQGLYKFLHRLLSKCFPIPPRAFSRSSSSIPPSSRPLRPTAWLDGVRGISAFLIFIYHFQHMFHNAYWYGYGSNGGVDDDWEFQLPILRLIPNGQTQVSVFYVLSGISLSLRPLQLARSHDWEKCLDTLFSSIFRRALRLYLPILVVQIGVLIATLLGFFNHAYALHSDWPFGGTNEVMHTVFASNRAQIQDWIQAMWTFADPFVPNRPAYDVHLWTIPIQFRNSIILFATLLGSAKLKPRVRISLTVLLVAYCICVNQSATALFYAGMGIAEFILIQADTVQRCSNTGTRNDGGKFLSRACWFAICYAGLHLLSWPPINSHRSLGFVTLNEIAPRFIESPGETGERIGAALFVLALSGCASLRRPFETPWAIYLGDISFPLYIVHGPLNHMIGLSLVQTIWKITGSESLVGYETGVFLAFCIMVVVVVWVAELFTRTVDELCVRLGRALQSKWTVKMAKPRTKTRSSLRIGEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.47
4 0.49
5 0.45
6 0.48
7 0.52
8 0.5
9 0.52
10 0.46
11 0.45
12 0.47
13 0.52
14 0.5
15 0.47
16 0.5
17 0.47
18 0.54
19 0.55
20 0.54
21 0.54
22 0.56
23 0.55
24 0.52
25 0.56
26 0.52
27 0.51
28 0.5
29 0.47
30 0.47
31 0.47
32 0.48
33 0.48
34 0.49
35 0.51
36 0.49
37 0.48
38 0.46
39 0.49
40 0.5
41 0.49
42 0.5
43 0.46
44 0.44
45 0.43
46 0.39
47 0.34
48 0.28
49 0.22
50 0.14
51 0.12
52 0.1
53 0.05
54 0.06
55 0.06
56 0.07
57 0.1
58 0.11
59 0.12
60 0.13
61 0.15
62 0.18
63 0.21
64 0.21
65 0.22
66 0.21
67 0.22
68 0.21
69 0.2
70 0.16
71 0.13
72 0.14
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.07
79 0.08
80 0.09
81 0.1
82 0.1
83 0.1
84 0.09
85 0.14
86 0.14
87 0.14
88 0.14
89 0.14
90 0.14
91 0.16
92 0.2
93 0.18
94 0.2
95 0.18
96 0.17
97 0.17
98 0.19
99 0.18
100 0.15
101 0.12
102 0.1
103 0.1
104 0.09
105 0.09
106 0.06
107 0.06
108 0.05
109 0.06
110 0.07
111 0.09
112 0.09
113 0.1
114 0.1
115 0.13
116 0.17
117 0.21
118 0.23
119 0.27
120 0.31
121 0.32
122 0.34
123 0.34
124 0.31
125 0.29
126 0.27
127 0.2
128 0.17
129 0.18
130 0.16
131 0.18
132 0.17
133 0.17
134 0.19
135 0.19
136 0.2
137 0.19
138 0.2
139 0.18
140 0.2
141 0.19
142 0.19
143 0.19
144 0.17
145 0.17
146 0.14
147 0.12
148 0.09
149 0.07
150 0.04
151 0.03
152 0.03
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.06
165 0.07
166 0.09
167 0.13
168 0.13
169 0.13
170 0.13
171 0.14
172 0.14
173 0.13
174 0.12
175 0.07
176 0.08
177 0.09
178 0.1
179 0.09
180 0.08
181 0.08
182 0.08
183 0.08
184 0.1
185 0.1
186 0.09
187 0.11
188 0.12
189 0.12
190 0.13
191 0.14
192 0.16
193 0.16
194 0.15
195 0.13
196 0.12
197 0.12
198 0.12
199 0.1
200 0.06
201 0.06
202 0.07
203 0.07
204 0.09
205 0.13
206 0.14
207 0.14
208 0.14
209 0.17
210 0.16
211 0.2
212 0.23
213 0.2
214 0.18
215 0.19
216 0.19
217 0.18
218 0.19
219 0.17
220 0.14
221 0.14
222 0.13
223 0.13
224 0.16
225 0.15
226 0.12
227 0.11
228 0.1
229 0.09
230 0.09
231 0.08
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.09
238 0.17
239 0.18
240 0.22
241 0.25
242 0.31
243 0.33
244 0.36
245 0.38
246 0.38
247 0.36
248 0.34
249 0.3
250 0.24
251 0.21
252 0.17
253 0.12
254 0.04
255 0.04
256 0.03
257 0.04
258 0.04
259 0.05
260 0.06
261 0.05
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.05
268 0.04
269 0.04
270 0.03
271 0.03
272 0.03
273 0.03
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.03
280 0.05
281 0.06
282 0.07
283 0.08
284 0.08
285 0.09
286 0.12
287 0.16
288 0.18
289 0.21
290 0.26
291 0.27
292 0.32
293 0.32
294 0.31
295 0.28
296 0.27
297 0.26
298 0.21
299 0.24
300 0.2
301 0.21
302 0.2
303 0.2
304 0.17
305 0.16
306 0.17
307 0.12
308 0.11
309 0.1
310 0.11
311 0.09
312 0.09
313 0.09
314 0.08
315 0.09
316 0.09
317 0.08
318 0.09
319 0.14
320 0.16
321 0.18
322 0.2
323 0.19
324 0.21
325 0.22
326 0.22
327 0.19
328 0.17
329 0.18
330 0.17
331 0.17
332 0.15
333 0.14
334 0.12
335 0.11
336 0.13
337 0.12
338 0.1
339 0.11
340 0.11
341 0.13
342 0.15
343 0.17
344 0.14
345 0.13
346 0.13
347 0.11
348 0.11
349 0.09
350 0.06
351 0.04
352 0.04
353 0.04
354 0.03
355 0.03
356 0.03
357 0.03
358 0.03
359 0.04
360 0.04
361 0.05
362 0.07
363 0.11
364 0.14
365 0.18
366 0.19
367 0.21
368 0.29
369 0.34
370 0.33
371 0.31
372 0.32
373 0.28
374 0.26
375 0.26
376 0.18
377 0.13
378 0.12
379 0.1
380 0.07
381 0.08
382 0.08
383 0.07
384 0.07
385 0.08
386 0.1
387 0.1
388 0.12
389 0.13
390 0.14
391 0.14
392 0.13
393 0.12
394 0.1
395 0.1
396 0.08
397 0.07
398 0.06
399 0.06
400 0.06
401 0.07
402 0.07
403 0.08
404 0.07
405 0.08
406 0.13
407 0.15
408 0.17
409 0.17
410 0.18
411 0.18
412 0.17
413 0.17
414 0.11
415 0.09
416 0.07
417 0.07
418 0.06
419 0.05
420 0.06
421 0.05
422 0.05
423 0.05
424 0.05
425 0.04
426 0.05
427 0.05
428 0.04
429 0.04
430 0.04
431 0.03
432 0.04
433 0.04
434 0.05
435 0.05
436 0.06
437 0.07
438 0.08
439 0.09
440 0.11
441 0.12
442 0.12
443 0.15
444 0.16
445 0.16
446 0.17
447 0.19
448 0.23
449 0.28
450 0.29
451 0.33
452 0.4
453 0.43
454 0.45
455 0.5
456 0.49
457 0.47
458 0.56
459 0.6
460 0.61
461 0.66
462 0.73
463 0.75
464 0.78
465 0.81
466 0.8
467 0.8
468 0.77