Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XFK4

Protein Details
Accession F0XFK4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-145HEVVRLRRLRRNGSNSRGREBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MAPAKQRSGADDHKADAAAASKGRDVRLTGASREQIQWMEFERDVLHAYVRTYQIESPSAFSNDLHRWMLSQPGSIGLQSPTMRRHKALRRQSKAQLASTTRKHSNNLGVQENDVIVDFLHKVQNHEVVRLRRLRRNGSNSRGREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.26
4 0.21
5 0.16
6 0.15
7 0.15
8 0.16
9 0.18
10 0.19
11 0.19
12 0.19
13 0.2
14 0.25
15 0.27
16 0.27
17 0.29
18 0.31
19 0.31
20 0.3
21 0.28
22 0.23
23 0.2
24 0.19
25 0.18
26 0.2
27 0.18
28 0.17
29 0.16
30 0.15
31 0.16
32 0.15
33 0.13
34 0.1
35 0.11
36 0.14
37 0.14
38 0.14
39 0.14
40 0.15
41 0.16
42 0.18
43 0.17
44 0.16
45 0.16
46 0.16
47 0.15
48 0.14
49 0.17
50 0.16
51 0.18
52 0.17
53 0.15
54 0.15
55 0.15
56 0.19
57 0.15
58 0.13
59 0.11
60 0.11
61 0.12
62 0.11
63 0.11
64 0.07
65 0.1
66 0.1
67 0.12
68 0.17
69 0.21
70 0.23
71 0.24
72 0.32
73 0.38
74 0.47
75 0.56
76 0.62
77 0.64
78 0.7
79 0.74
80 0.75
81 0.69
82 0.62
83 0.58
84 0.52
85 0.52
86 0.5
87 0.5
88 0.47
89 0.46
90 0.45
91 0.43
92 0.46
93 0.45
94 0.45
95 0.43
96 0.38
97 0.37
98 0.35
99 0.31
100 0.23
101 0.17
102 0.12
103 0.06
104 0.07
105 0.07
106 0.08
107 0.13
108 0.13
109 0.16
110 0.19
111 0.27
112 0.27
113 0.32
114 0.38
115 0.38
116 0.45
117 0.51
118 0.55
119 0.54
120 0.61
121 0.65
122 0.68
123 0.73
124 0.76
125 0.77
126 0.81