Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XR90

Protein Details
Accession F0XR90    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-86DALVCHRRGKPHRRRVKQLTEVPYHydrophilic
NLS Segment(s)
PositionSequence
70-77RGKPHRRR
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGVVNKRTLTKTRRKTRDVDQIKADLASPAHLARHTSSKAAEDLPGLGRHYCISCAKWYESADALVCHRRGKPHRRRVKQLTEVPYTQKEAEAAIGLRTDNGESTVDAAASRQLIGQASQTGDIAMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.78
4 0.8
5 0.77
6 0.72
7 0.67
8 0.6
9 0.55
10 0.5
11 0.4
12 0.3
13 0.23
14 0.18
15 0.14
16 0.12
17 0.12
18 0.12
19 0.13
20 0.13
21 0.2
22 0.19
23 0.2
24 0.2
25 0.2
26 0.21
27 0.2
28 0.19
29 0.13
30 0.13
31 0.14
32 0.14
33 0.13
34 0.12
35 0.11
36 0.12
37 0.12
38 0.13
39 0.13
40 0.13
41 0.14
42 0.17
43 0.18
44 0.2
45 0.21
46 0.2
47 0.18
48 0.18
49 0.15
50 0.13
51 0.13
52 0.14
53 0.14
54 0.14
55 0.14
56 0.21
57 0.3
58 0.4
59 0.5
60 0.57
61 0.67
62 0.73
63 0.82
64 0.84
65 0.86
66 0.84
67 0.81
68 0.77
69 0.72
70 0.66
71 0.6
72 0.53
73 0.45
74 0.36
75 0.28
76 0.21
77 0.17
78 0.15
79 0.13
80 0.11
81 0.09
82 0.09
83 0.08
84 0.08
85 0.09
86 0.08
87 0.07
88 0.08
89 0.08
90 0.08
91 0.1
92 0.1
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.09
101 0.1
102 0.11
103 0.13
104 0.14
105 0.14
106 0.15
107 0.15