Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XFP5

Protein Details
Accession F0XFP5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
113-138SKSLSAHFQKPKKSNRRKESDASTSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 6, cyto 4.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSFTVTEPHPTVPANAYTYSGRGGLGNTFRAPATTPAEGVPTTLTRIGSASSSSPATGTVRYYAGRGGAGNAHPVSQRRELSLDDEYVYATAVAGAATSGHVGRGGAGNVFSSKSLSAHFQKPKKSNRRKESDASTSTSGSSDGNIRSGFWSRFRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.22
5 0.22
6 0.21
7 0.18
8 0.15
9 0.12
10 0.13
11 0.15
12 0.17
13 0.18
14 0.18
15 0.18
16 0.18
17 0.18
18 0.19
19 0.18
20 0.2
21 0.18
22 0.18
23 0.17
24 0.19
25 0.19
26 0.17
27 0.15
28 0.11
29 0.12
30 0.13
31 0.12
32 0.11
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.09
42 0.1
43 0.1
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.09
54 0.08
55 0.09
56 0.09
57 0.11
58 0.1
59 0.11
60 0.11
61 0.13
62 0.16
63 0.19
64 0.19
65 0.17
66 0.19
67 0.19
68 0.21
69 0.21
70 0.17
71 0.13
72 0.13
73 0.12
74 0.1
75 0.1
76 0.06
77 0.04
78 0.04
79 0.03
80 0.03
81 0.02
82 0.02
83 0.02
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.04
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.14
104 0.18
105 0.27
106 0.36
107 0.4
108 0.49
109 0.57
110 0.67
111 0.73
112 0.79
113 0.81
114 0.83
115 0.87
116 0.85
117 0.84
118 0.83
119 0.81
120 0.73
121 0.68
122 0.6
123 0.51
124 0.44
125 0.37
126 0.28
127 0.19
128 0.17
129 0.16
130 0.14
131 0.17
132 0.17
133 0.17
134 0.2
135 0.26
136 0.27