Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UF61

Protein Details
Accession Q0UF61   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-63AEGRVQRGPRHARRRACGPDTBasic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9, mito 8.5, cyto 8.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001830  Glyco_trans_20  
Gene Ontology GO:0005946  C:alpha,alpha-trehalose-phosphate synthase complex (UDP-forming)  
GO:0003825  F:alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity  
GO:0030437  P:ascospore formation  
GO:0034605  P:cellular response to heat  
GO:0005992  P:trehalose biosynthetic process  
GO:0005993  P:trehalose catabolic process  
GO:0070413  P:trehalose metabolism in response to stress  
KEGG pno:SNOG_09603  -  
Pfam View protein in Pfam  
PF00982  Glyco_transf_20  
CDD cd03788  GT20_TPS  
Amino Acid Sequences MSMSSGGLVSGLSGLAKTTTFQWYGWAGSRGARGRDQAALGPAEGRVQRGPRHARRRACGPDTTTASQVRPPHHSVICFCSSYSHTNRQMPSCGRFSTTTPGEITSDESAWEAYTQANRLFAQAVARDVQDNDMVWVHDYHLMLMPQMLREEIGNTKKNVKIGFFLHTPFPSSEIYRILPVRNEILRGVLDCDLIGFHTYDYARHFLSSCSRILGLATTPNGVEYKGRHITVGAFPIGIDPEKFDEGLKKPKVQERIAALEKKFQGVKLIVGVDRLDYIKGVPQKLHALEVFLTEHPEWIGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTVEFMPIHFMHKSVSFDELIALYSVSDVCLVSSTRDGMNLVSYEYIATQEKRHGVMILSEFTGAAQSLNGSLVVNPWNTEELADSIHEAVTMGDEQRSLNYQKLSKYVRKYTSAWWGESFVTELRRISATLDRKVQFASKPASDTKPEDIGAALPKQGESLTTKDKESDPAAAVEDNKESAAIELPIQPKKSATQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.07
5 0.1
6 0.15
7 0.17
8 0.17
9 0.21
10 0.22
11 0.25
12 0.29
13 0.29
14 0.24
15 0.26
16 0.34
17 0.35
18 0.37
19 0.37
20 0.35
21 0.35
22 0.38
23 0.36
24 0.32
25 0.3
26 0.27
27 0.24
28 0.22
29 0.19
30 0.2
31 0.19
32 0.19
33 0.2
34 0.24
35 0.28
36 0.37
37 0.48
38 0.54
39 0.64
40 0.7
41 0.75
42 0.76
43 0.81
44 0.81
45 0.76
46 0.73
47 0.66
48 0.66
49 0.64
50 0.6
51 0.55
52 0.48
53 0.44
54 0.41
55 0.42
56 0.38
57 0.37
58 0.39
59 0.42
60 0.42
61 0.44
62 0.43
63 0.44
64 0.44
65 0.38
66 0.33
67 0.3
68 0.3
69 0.35
70 0.39
71 0.41
72 0.44
73 0.5
74 0.54
75 0.54
76 0.58
77 0.56
78 0.55
79 0.5
80 0.44
81 0.41
82 0.39
83 0.38
84 0.38
85 0.35
86 0.32
87 0.28
88 0.28
89 0.26
90 0.24
91 0.25
92 0.19
93 0.17
94 0.14
95 0.14
96 0.12
97 0.11
98 0.11
99 0.08
100 0.08
101 0.1
102 0.13
103 0.13
104 0.16
105 0.16
106 0.17
107 0.17
108 0.16
109 0.17
110 0.16
111 0.17
112 0.15
113 0.16
114 0.16
115 0.15
116 0.16
117 0.14
118 0.12
119 0.12
120 0.11
121 0.11
122 0.11
123 0.11
124 0.11
125 0.13
126 0.13
127 0.13
128 0.14
129 0.14
130 0.13
131 0.14
132 0.14
133 0.11
134 0.11
135 0.1
136 0.08
137 0.08
138 0.1
139 0.15
140 0.21
141 0.24
142 0.26
143 0.31
144 0.33
145 0.36
146 0.36
147 0.31
148 0.28
149 0.27
150 0.3
151 0.26
152 0.26
153 0.26
154 0.24
155 0.25
156 0.21
157 0.21
158 0.18
159 0.18
160 0.18
161 0.18
162 0.18
163 0.19
164 0.21
165 0.2
166 0.19
167 0.2
168 0.22
169 0.2
170 0.2
171 0.17
172 0.17
173 0.16
174 0.15
175 0.15
176 0.12
177 0.11
178 0.09
179 0.09
180 0.07
181 0.07
182 0.08
183 0.06
184 0.05
185 0.07
186 0.08
187 0.09
188 0.11
189 0.13
190 0.12
191 0.13
192 0.13
193 0.12
194 0.18
195 0.19
196 0.17
197 0.17
198 0.16
199 0.16
200 0.15
201 0.15
202 0.1
203 0.1
204 0.1
205 0.09
206 0.09
207 0.09
208 0.09
209 0.09
210 0.09
211 0.08
212 0.15
213 0.18
214 0.18
215 0.17
216 0.18
217 0.2
218 0.2
219 0.21
220 0.15
221 0.11
222 0.11
223 0.11
224 0.11
225 0.09
226 0.07
227 0.05
228 0.07
229 0.08
230 0.08
231 0.08
232 0.12
233 0.15
234 0.25
235 0.26
236 0.28
237 0.31
238 0.36
239 0.43
240 0.39
241 0.4
242 0.35
243 0.39
244 0.41
245 0.42
246 0.37
247 0.36
248 0.35
249 0.32
250 0.28
251 0.22
252 0.2
253 0.16
254 0.16
255 0.12
256 0.13
257 0.11
258 0.12
259 0.12
260 0.09
261 0.09
262 0.09
263 0.07
264 0.05
265 0.06
266 0.09
267 0.12
268 0.12
269 0.12
270 0.14
271 0.17
272 0.18
273 0.2
274 0.16
275 0.14
276 0.14
277 0.15
278 0.14
279 0.11
280 0.13
281 0.1
282 0.11
283 0.1
284 0.1
285 0.08
286 0.07
287 0.07
288 0.05
289 0.05
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.07
296 0.08
297 0.07
298 0.07
299 0.07
300 0.07
301 0.08
302 0.08
303 0.13
304 0.19
305 0.21
306 0.21
307 0.23
308 0.23
309 0.22
310 0.21
311 0.17
312 0.11
313 0.11
314 0.1
315 0.08
316 0.08
317 0.09
318 0.09
319 0.08
320 0.09
321 0.07
322 0.07
323 0.07
324 0.06
325 0.1
326 0.09
327 0.12
328 0.11
329 0.11
330 0.14
331 0.14
332 0.16
333 0.12
334 0.13
335 0.11
336 0.14
337 0.15
338 0.14
339 0.16
340 0.14
341 0.14
342 0.14
343 0.13
344 0.11
345 0.09
346 0.08
347 0.05
348 0.05
349 0.05
350 0.05
351 0.05
352 0.04
353 0.04
354 0.05
355 0.06
356 0.07
357 0.08
358 0.09
359 0.09
360 0.1
361 0.1
362 0.09
363 0.11
364 0.1
365 0.1
366 0.08
367 0.08
368 0.08
369 0.07
370 0.09
371 0.1
372 0.11
373 0.12
374 0.16
375 0.19
376 0.2
377 0.2
378 0.19
379 0.18
380 0.21
381 0.22
382 0.19
383 0.17
384 0.16
385 0.15
386 0.13
387 0.13
388 0.09
389 0.06
390 0.05
391 0.04
392 0.05
393 0.05
394 0.06
395 0.05
396 0.05
397 0.07
398 0.1
399 0.1
400 0.1
401 0.11
402 0.12
403 0.12
404 0.12
405 0.12
406 0.1
407 0.11
408 0.1
409 0.1
410 0.09
411 0.09
412 0.09
413 0.08
414 0.07
415 0.07
416 0.08
417 0.08
418 0.08
419 0.08
420 0.09
421 0.1
422 0.14
423 0.15
424 0.18
425 0.22
426 0.25
427 0.28
428 0.35
429 0.42
430 0.46
431 0.52
432 0.58
433 0.59
434 0.61
435 0.61
436 0.59
437 0.62
438 0.59
439 0.52
440 0.45
441 0.41
442 0.36
443 0.34
444 0.3
445 0.21
446 0.2
447 0.19
448 0.18
449 0.18
450 0.18
451 0.18
452 0.19
453 0.25
454 0.29
455 0.33
456 0.42
457 0.4
458 0.4
459 0.42
460 0.44
461 0.38
462 0.38
463 0.38
464 0.32
465 0.36
466 0.4
467 0.43
468 0.43
469 0.45
470 0.43
471 0.41
472 0.38
473 0.34
474 0.3
475 0.28
476 0.27
477 0.24
478 0.21
479 0.17
480 0.17
481 0.17
482 0.16
483 0.16
484 0.15
485 0.2
486 0.27
487 0.29
488 0.3
489 0.33
490 0.35
491 0.37
492 0.37
493 0.35
494 0.28
495 0.28
496 0.29
497 0.27
498 0.27
499 0.24
500 0.23
501 0.19
502 0.17
503 0.15
504 0.14
505 0.12
506 0.13
507 0.12
508 0.12
509 0.18
510 0.24
511 0.29
512 0.31
513 0.31