Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XFM9

Protein Details
Accession F0XFM9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
278-301NKQVEKATKSARNRRKLKWFCLLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.5, cyto 7, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010989  SNARE  
IPR045242  Syntaxin  
IPR006011  Syntaxin_N  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF05739  SNARE  
PF00804  Syntaxin  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15849  SNARE_Sso1  
Amino Acid Sequences MSYSNNTYQAQSPYETENQYSQYQGNPYEQTPGAETGNGYGQPEQHEMQPYGQPANAGAPVMTQQEYLAQVSSVRGEIRSLTTSVQSIAGLHQRALGGNEPGAAQQLEQLVAQTQLKNTQIRNQLRLLQRDCERTTDSLHALKKRQFETLNNDFKKELQSYMNEEKQYRETYREQIARQYRIVNPEATETEVAQAADADWGSEGIFQTALRTNRSGQATAVLGAVRARHNELQRIEQSITELNGLFNDLDTLVIQQDPVFSQVEDQTQNAVGNLESANKQVEKATKSARNRRKLKWFCLLVVVLIIIAIALGVGLGVALNKNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.32
5 0.33
6 0.32
7 0.32
8 0.28
9 0.26
10 0.28
11 0.28
12 0.3
13 0.29
14 0.28
15 0.31
16 0.31
17 0.28
18 0.27
19 0.27
20 0.22
21 0.2
22 0.19
23 0.15
24 0.18
25 0.17
26 0.16
27 0.14
28 0.15
29 0.18
30 0.22
31 0.21
32 0.22
33 0.26
34 0.26
35 0.28
36 0.3
37 0.28
38 0.26
39 0.26
40 0.22
41 0.18
42 0.19
43 0.17
44 0.13
45 0.11
46 0.09
47 0.11
48 0.13
49 0.13
50 0.1
51 0.09
52 0.11
53 0.13
54 0.13
55 0.12
56 0.09
57 0.1
58 0.1
59 0.11
60 0.1
61 0.09
62 0.09
63 0.09
64 0.1
65 0.13
66 0.14
67 0.14
68 0.14
69 0.15
70 0.15
71 0.15
72 0.14
73 0.11
74 0.1
75 0.11
76 0.15
77 0.15
78 0.14
79 0.15
80 0.15
81 0.15
82 0.16
83 0.16
84 0.12
85 0.11
86 0.12
87 0.1
88 0.1
89 0.11
90 0.09
91 0.07
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.07
98 0.09
99 0.1
100 0.1
101 0.1
102 0.13
103 0.16
104 0.19
105 0.2
106 0.26
107 0.34
108 0.37
109 0.4
110 0.38
111 0.42
112 0.44
113 0.51
114 0.46
115 0.42
116 0.42
117 0.45
118 0.44
119 0.4
120 0.36
121 0.3
122 0.31
123 0.27
124 0.26
125 0.25
126 0.28
127 0.29
128 0.31
129 0.34
130 0.37
131 0.35
132 0.38
133 0.35
134 0.36
135 0.4
136 0.45
137 0.51
138 0.46
139 0.46
140 0.41
141 0.39
142 0.38
143 0.31
144 0.23
145 0.15
146 0.17
147 0.22
148 0.28
149 0.31
150 0.29
151 0.28
152 0.28
153 0.28
154 0.3
155 0.25
156 0.24
157 0.23
158 0.26
159 0.32
160 0.35
161 0.32
162 0.37
163 0.42
164 0.4
165 0.38
166 0.38
167 0.33
168 0.33
169 0.34
170 0.27
171 0.22
172 0.21
173 0.21
174 0.18
175 0.17
176 0.12
177 0.11
178 0.11
179 0.1
180 0.08
181 0.07
182 0.05
183 0.06
184 0.05
185 0.05
186 0.03
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.07
195 0.12
196 0.14
197 0.15
198 0.16
199 0.17
200 0.23
201 0.25
202 0.24
203 0.19
204 0.2
205 0.19
206 0.18
207 0.17
208 0.11
209 0.09
210 0.09
211 0.11
212 0.1
213 0.11
214 0.14
215 0.18
216 0.21
217 0.27
218 0.29
219 0.34
220 0.34
221 0.37
222 0.34
223 0.29
224 0.29
225 0.24
226 0.22
227 0.17
228 0.15
229 0.11
230 0.1
231 0.11
232 0.09
233 0.07
234 0.07
235 0.06
236 0.06
237 0.06
238 0.07
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.07
245 0.09
246 0.09
247 0.08
248 0.11
249 0.13
250 0.17
251 0.17
252 0.17
253 0.17
254 0.17
255 0.17
256 0.16
257 0.14
258 0.1
259 0.1
260 0.1
261 0.11
262 0.11
263 0.12
264 0.15
265 0.15
266 0.16
267 0.18
268 0.24
269 0.24
270 0.29
271 0.37
272 0.42
273 0.52
274 0.63
275 0.68
276 0.72
277 0.78
278 0.82
279 0.85
280 0.85
281 0.83
282 0.83
283 0.77
284 0.69
285 0.67
286 0.58
287 0.47
288 0.38
289 0.3
290 0.19
291 0.14
292 0.12
293 0.05
294 0.04
295 0.03
296 0.02
297 0.02
298 0.01
299 0.01
300 0.01
301 0.02
302 0.02
303 0.03
304 0.04