Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XSL9

Protein Details
Accession F0XSL9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-35TPQERPYKARPSRSQQLRNPKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MLRPRHYSYECKVTPQERPYKARPSRSQQLRNPKLVPKLHEDTFNALQIKEGVADQELAKREAERAKTQKHGDKEGNKSSETKRGRQRSTLDLPCLPFPFAIRVSRQSSRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.61
4 0.57
5 0.63
6 0.64
7 0.68
8 0.72
9 0.74
10 0.73
11 0.72
12 0.75
13 0.79
14 0.82
15 0.79
16 0.83
17 0.8
18 0.78
19 0.73
20 0.68
21 0.66
22 0.6
23 0.55
24 0.51
25 0.49
26 0.44
27 0.44
28 0.4
29 0.37
30 0.35
31 0.35
32 0.28
33 0.23
34 0.21
35 0.18
36 0.17
37 0.11
38 0.09
39 0.05
40 0.05
41 0.06
42 0.06
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.13
49 0.16
50 0.2
51 0.24
52 0.3
53 0.33
54 0.4
55 0.45
56 0.49
57 0.48
58 0.52
59 0.52
60 0.53
61 0.57
62 0.59
63 0.56
64 0.51
65 0.51
66 0.47
67 0.49
68 0.46
69 0.46
70 0.48
71 0.55
72 0.58
73 0.61
74 0.63
75 0.62
76 0.67
77 0.65
78 0.6
79 0.55
80 0.53
81 0.5
82 0.47
83 0.39
84 0.3
85 0.25
86 0.25
87 0.24
88 0.26
89 0.27
90 0.31
91 0.37
92 0.42