Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XKV0

Protein Details
Accession F0XKV0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-69AVAPACKRSHPRRNTVKRTTTHKRTPTPARIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, extr 4
Family & Domain DBs
Amino Acid Sequences MSSFAARGIFLLASGSGRKAADTIDTLSPSRALATRSAVAPACKRSHPRRNTVKRTTTHKRTPTPARIPFVALMGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.1
6 0.1
7 0.1
8 0.1
9 0.11
10 0.14
11 0.14
12 0.16
13 0.16
14 0.16
15 0.16
16 0.14
17 0.13
18 0.11
19 0.1
20 0.1
21 0.12
22 0.13
23 0.13
24 0.14
25 0.14
26 0.14
27 0.16
28 0.19
29 0.18
30 0.21
31 0.28
32 0.36
33 0.46
34 0.51
35 0.58
36 0.65
37 0.74
38 0.81
39 0.83
40 0.82
41 0.78
42 0.81
43 0.81
44 0.8
45 0.79
46 0.78
47 0.75
48 0.75
49 0.79
50 0.8
51 0.8
52 0.78
53 0.74
54 0.66
55 0.63
56 0.55