Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XUX9

Protein Details
Accession F0XUX9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VKAATKVKTGKVEKRRSKKDPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
8-27VKTGKVEKRRSKKDPNAPKR
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MVKAATKVKTGKVEKRRSKKDPNAPKRGLSAYMFFANEQRENVRDENPGISFGQVGKILGERWKALNEKQRTPYEAKAAADKKRYEDAKAAYNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.86
4 0.85
5 0.89
6 0.89
7 0.89
8 0.9
9 0.9
10 0.89
11 0.83
12 0.76
13 0.69
14 0.61
15 0.54
16 0.44
17 0.35
18 0.28
19 0.26
20 0.24
21 0.2
22 0.2
23 0.19
24 0.18
25 0.16
26 0.15
27 0.14
28 0.17
29 0.18
30 0.17
31 0.16
32 0.16
33 0.16
34 0.15
35 0.15
36 0.12
37 0.11
38 0.09
39 0.08
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.11
47 0.12
48 0.12
49 0.13
50 0.17
51 0.19
52 0.24
53 0.33
54 0.36
55 0.42
56 0.48
57 0.51
58 0.52
59 0.54
60 0.53
61 0.5
62 0.48
63 0.42
64 0.44
65 0.46
66 0.48
67 0.51
68 0.49
69 0.46
70 0.5
71 0.51
72 0.46
73 0.48
74 0.45