Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XAB1

Protein Details
Accession F0XAB1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
93-119HSSVKRRCEHCKVVRRKGGKRHKGYMYBasic
NLS Segment(s)
PositionSequence
107-115RRKGGKRHK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MAMSLSQIPRLLSQSMLSATVSRVRPTAAVPALSAAFAALRVNVHQQPQQRRACSGNCNATGLSLVASRPSVSLVAAAAQKIVQQQRRGMKVHSSVKRRCEHCKVVRRKGGKRHKGYMYIICPANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.15
5 0.13
6 0.14
7 0.2
8 0.2
9 0.19
10 0.18
11 0.18
12 0.18
13 0.19
14 0.25
15 0.2
16 0.19
17 0.18
18 0.19
19 0.18
20 0.17
21 0.15
22 0.08
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.06
29 0.1
30 0.12
31 0.15
32 0.18
33 0.25
34 0.33
35 0.42
36 0.47
37 0.44
38 0.45
39 0.46
40 0.46
41 0.45
42 0.43
43 0.4
44 0.35
45 0.35
46 0.32
47 0.28
48 0.24
49 0.19
50 0.13
51 0.07
52 0.06
53 0.05
54 0.06
55 0.06
56 0.05
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.07
68 0.11
69 0.17
70 0.19
71 0.22
72 0.28
73 0.34
74 0.39
75 0.4
76 0.38
77 0.39
78 0.43
79 0.5
80 0.52
81 0.54
82 0.55
83 0.61
84 0.67
85 0.66
86 0.66
87 0.65
88 0.68
89 0.69
90 0.74
91 0.76
92 0.79
93 0.83
94 0.84
95 0.83
96 0.84
97 0.85
98 0.85
99 0.83
100 0.81
101 0.8
102 0.78
103 0.75
104 0.73
105 0.66
106 0.62
107 0.55
108 0.48
109 0.45
110 0.43
111 0.48
112 0.48
113 0.52