Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XQ33

Protein Details
Accession F0XQ33    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-90IRSNRKKAAKSKVTATKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-90NRKKAAKSKVTATKKKA
Subcellular Location(s) plas 18, E.R. 5, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKLVGLAMLVAATVVFLYYTVWTLLMPFVDVDHPLQNCFPPRVWAIRIPVILILLGTAVVGSFLSIVMIRSNRKKAAKSKVTATKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.05
17 0.06
18 0.06
19 0.07
20 0.08
21 0.11
22 0.11
23 0.11
24 0.12
25 0.13
26 0.15
27 0.16
28 0.15
29 0.14
30 0.15
31 0.18
32 0.19
33 0.2
34 0.22
35 0.24
36 0.23
37 0.21
38 0.19
39 0.16
40 0.14
41 0.11
42 0.07
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.07
57 0.1
58 0.16
59 0.23
60 0.29
61 0.36
62 0.41
63 0.48
64 0.55
65 0.63
66 0.67
67 0.66
68 0.7
69 0.73
70 0.79