Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XIU0

Protein Details
Accession F0XIU0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-75STSPTKKTKAGKKKAEDPGELHydrophilic
NLS Segment(s)
PositionSequence
45-51RKRKTKA
57-68SPTKKTKAGKKK
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MFTILTGHPNSANARKRFGEIKKRVREQVFSEGDGIPISVPSTPRKRKTKANDDSTSPTKKTKAGKKKAEDPGELGDSVKTEPSDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.43
4 0.48
5 0.53
6 0.55
7 0.57
8 0.65
9 0.69
10 0.74
11 0.78
12 0.72
13 0.67
14 0.61
15 0.61
16 0.53
17 0.44
18 0.4
19 0.33
20 0.29
21 0.25
22 0.2
23 0.09
24 0.07
25 0.06
26 0.05
27 0.06
28 0.11
29 0.21
30 0.28
31 0.36
32 0.44
33 0.48
34 0.57
35 0.65
36 0.71
37 0.72
38 0.74
39 0.7
40 0.67
41 0.69
42 0.65
43 0.6
44 0.51
45 0.44
46 0.37
47 0.39
48 0.43
49 0.47
50 0.52
51 0.58
52 0.66
53 0.71
54 0.79
55 0.84
56 0.82
57 0.73
58 0.66
59 0.61
60 0.54
61 0.46
62 0.36
63 0.27
64 0.21
65 0.2
66 0.19