Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XU44

Protein Details
Accession F0XU44    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-71SDSLDLKEKERRRNRRRYDEDRBasic
NLS Segment(s)
PositionSequence
58-66KERRRNRRR
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MAVLLLLPAVSSKAYRTRKNWELRCILFRGKLRVGTTEAEAKSSSSSGVSDSLDLKEKERRRNRRRYDEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.38
4 0.47
5 0.55
6 0.65
7 0.69
8 0.67
9 0.67
10 0.64
11 0.63
12 0.57
13 0.51
14 0.46
15 0.42
16 0.4
17 0.34
18 0.34
19 0.31
20 0.29
21 0.29
22 0.24
23 0.23
24 0.23
25 0.21
26 0.19
27 0.18
28 0.16
29 0.15
30 0.14
31 0.12
32 0.07
33 0.07
34 0.07
35 0.09
36 0.09
37 0.09
38 0.1
39 0.12
40 0.17
41 0.17
42 0.19
43 0.26
44 0.33
45 0.43
46 0.52
47 0.62
48 0.67
49 0.78
50 0.86
51 0.89