Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0X7Y7

Protein Details
Accession F0X7Y7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-167IKPDMERKEKERRRKRWEQIIEMBasic
NLS Segment(s)
PositionSequence
151-160RKEKERRRKR
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024974  Sde2_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF13019  Sde2_N_Ubi  
Amino Acid Sequences MDEKIVNVLVAGIPSEGHPSTYSLPTSTSTTISELWDIIYEVLPPIQSRLILTTLSNRQLLGTSERTICGLLSSPEDDFISLRLSLPVLGGKGGFGSQLRAAGGRMSSKRKKNNQGEDNGSSRNLDGRRLRTVTEAKALAEYLAIKPDMERKEKERRRKRWEQIIEMTEKKEDDIKHGGRGRLDGKWVEDKDEANDRTRAAVLAAMKKGQFTDVGSGLQHLSTSIGSGTSAFASAESASGSNDEVESEDSDASDSASSEPKPTSASVAAATTGPAKTNSKGKGKAFFAFDEDDEFMSSDESDGEEAKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.12
3 0.11
4 0.12
5 0.13
6 0.15
7 0.19
8 0.22
9 0.23
10 0.19
11 0.21
12 0.22
13 0.25
14 0.24
15 0.22
16 0.2
17 0.21
18 0.21
19 0.21
20 0.2
21 0.16
22 0.15
23 0.13
24 0.13
25 0.11
26 0.1
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.1
35 0.11
36 0.13
37 0.14
38 0.14
39 0.15
40 0.2
41 0.25
42 0.28
43 0.27
44 0.25
45 0.24
46 0.24
47 0.26
48 0.24
49 0.22
50 0.21
51 0.22
52 0.22
53 0.22
54 0.21
55 0.19
56 0.14
57 0.12
58 0.1
59 0.11
60 0.13
61 0.12
62 0.13
63 0.13
64 0.12
65 0.11
66 0.11
67 0.1
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.06
79 0.07
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.14
92 0.18
93 0.26
94 0.33
95 0.41
96 0.51
97 0.59
98 0.69
99 0.74
100 0.8
101 0.79
102 0.78
103 0.77
104 0.71
105 0.65
106 0.55
107 0.45
108 0.35
109 0.27
110 0.25
111 0.19
112 0.21
113 0.23
114 0.25
115 0.3
116 0.31
117 0.32
118 0.32
119 0.35
120 0.31
121 0.3
122 0.27
123 0.22
124 0.21
125 0.2
126 0.15
127 0.11
128 0.1
129 0.06
130 0.07
131 0.07
132 0.06
133 0.07
134 0.14
135 0.17
136 0.2
137 0.22
138 0.26
139 0.38
140 0.45
141 0.56
142 0.6
143 0.66
144 0.72
145 0.8
146 0.83
147 0.83
148 0.83
149 0.79
150 0.75
151 0.69
152 0.64
153 0.55
154 0.47
155 0.37
156 0.3
157 0.23
158 0.2
159 0.17
160 0.17
161 0.23
162 0.23
163 0.3
164 0.34
165 0.35
166 0.31
167 0.34
168 0.32
169 0.25
170 0.27
171 0.21
172 0.2
173 0.25
174 0.25
175 0.25
176 0.24
177 0.24
178 0.24
179 0.31
180 0.3
181 0.25
182 0.26
183 0.23
184 0.23
185 0.23
186 0.2
187 0.12
188 0.13
189 0.13
190 0.16
191 0.17
192 0.18
193 0.17
194 0.18
195 0.18
196 0.16
197 0.14
198 0.1
199 0.13
200 0.12
201 0.13
202 0.13
203 0.13
204 0.13
205 0.12
206 0.1
207 0.07
208 0.07
209 0.06
210 0.06
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.06
226 0.07
227 0.07
228 0.07
229 0.06
230 0.06
231 0.07
232 0.08
233 0.09
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.09
240 0.08
241 0.07
242 0.08
243 0.12
244 0.12
245 0.14
246 0.14
247 0.15
248 0.17
249 0.16
250 0.19
251 0.17
252 0.18
253 0.17
254 0.17
255 0.17
256 0.15
257 0.15
258 0.13
259 0.12
260 0.12
261 0.14
262 0.17
263 0.2
264 0.27
265 0.34
266 0.4
267 0.48
268 0.51
269 0.57
270 0.58
271 0.6
272 0.56
273 0.5
274 0.45
275 0.41
276 0.36
277 0.32
278 0.29
279 0.24
280 0.21
281 0.2
282 0.16
283 0.14
284 0.13
285 0.09
286 0.08
287 0.08
288 0.08
289 0.09