Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XGY2

Protein Details
Accession F0XGY2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-73KYTLFDRKAKRYRKSIHKLPKWTRVSQRIHydrophilic
NLS Segment(s)
PositionSequence
52-63KAKRYRKSIHKL
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MRLRAVDSVISTVDKALEKQGTTLKALELWKAQMPTEKEMLPRDKYTLFDRKAKRYRKSIHKLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.15
4 0.17
5 0.16
6 0.18
7 0.23
8 0.22
9 0.23
10 0.23
11 0.18
12 0.2
13 0.2
14 0.2
15 0.16
16 0.16
17 0.17
18 0.17
19 0.17
20 0.18
21 0.19
22 0.2
23 0.21
24 0.2
25 0.2
26 0.23
27 0.27
28 0.26
29 0.24
30 0.24
31 0.23
32 0.24
33 0.28
34 0.33
35 0.32
36 0.38
37 0.42
38 0.51
39 0.59
40 0.66
41 0.67
42 0.68
43 0.74
44 0.77
45 0.81
46 0.82
47 0.84
48 0.84
49 0.88
50 0.86
51 0.87
52 0.83
53 0.81
54 0.8
55 0.8
56 0.79
57 0.77
58 0.79