Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XDF7

Protein Details
Accession F0XDF7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
47-70IHYATMKPGQKKKKPTDAKPPAKRBasic
NLS Segment(s)
PositionSequence
54-70PGQKKKKPTDAKPPAKR
Subcellular Location(s) plas 9, cyto 6.5, cyto_nucl 5.5, nucl 3.5, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGEFDWFSKIGATKEAVAVLNDQPILFTILIIVLIAVALLITLIWYIHYATMKPGQKKKKPTDAKPPAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.15
5 0.16
6 0.14
7 0.14
8 0.13
9 0.12
10 0.1
11 0.1
12 0.11
13 0.09
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.02
21 0.02
22 0.02
23 0.02
24 0.01
25 0.01
26 0.01
27 0.01
28 0.01
29 0.02
30 0.02
31 0.02
32 0.03
33 0.04
34 0.06
35 0.07
36 0.07
37 0.1
38 0.18
39 0.25
40 0.32
41 0.41
42 0.5
43 0.57
44 0.68
45 0.74
46 0.78
47 0.82
48 0.83
49 0.86
50 0.87