Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XR39

Protein Details
Accession F0XR39    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
110-130ATSRRGKEPKKGRIRRLLGRHBasic
NLS Segment(s)
PositionSequence
27-38VRHREKGRGRRR
112-141SRRGKEPKKGRIRRLLGRHVSRRVAVRRGL
Subcellular Location(s) cyto 16, mito 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MAIWVEKESSGDRAQVCWLQAWVTGKVRHREKGRGRRRLVDEAGATGQLAVRVWAILEGRSDGVCRVHGRFEQKSDVCSLSPDRHTPTALTFWYASGVGVPACRKQGEGATSRRGKEPKKGRIRRLLGRHVSRRVAVRRGLAETAGRTGRRPLLLFRAVRCWMRDKHSSEAVVAFGTEGPRILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.24
4 0.22
5 0.21
6 0.17
7 0.19
8 0.22
9 0.23
10 0.26
11 0.3
12 0.35
13 0.44
14 0.49
15 0.53
16 0.56
17 0.61
18 0.66
19 0.72
20 0.76
21 0.78
22 0.77
23 0.79
24 0.8
25 0.78
26 0.69
27 0.64
28 0.54
29 0.46
30 0.42
31 0.32
32 0.25
33 0.17
34 0.14
35 0.09
36 0.08
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.08
47 0.09
48 0.09
49 0.08
50 0.09
51 0.11
52 0.12
53 0.12
54 0.15
55 0.18
56 0.24
57 0.25
58 0.27
59 0.33
60 0.31
61 0.31
62 0.3
63 0.29
64 0.22
65 0.22
66 0.22
67 0.18
68 0.19
69 0.2
70 0.21
71 0.21
72 0.22
73 0.2
74 0.19
75 0.18
76 0.16
77 0.15
78 0.12
79 0.11
80 0.11
81 0.11
82 0.09
83 0.06
84 0.06
85 0.05
86 0.06
87 0.07
88 0.07
89 0.09
90 0.09
91 0.09
92 0.1
93 0.13
94 0.16
95 0.21
96 0.24
97 0.31
98 0.34
99 0.35
100 0.4
101 0.42
102 0.4
103 0.45
104 0.51
105 0.53
106 0.61
107 0.68
108 0.72
109 0.77
110 0.81
111 0.81
112 0.79
113 0.79
114 0.76
115 0.76
116 0.75
117 0.71
118 0.66
119 0.6
120 0.59
121 0.55
122 0.51
123 0.45
124 0.42
125 0.39
126 0.4
127 0.37
128 0.31
129 0.28
130 0.23
131 0.24
132 0.24
133 0.22
134 0.2
135 0.23
136 0.26
137 0.27
138 0.28
139 0.27
140 0.31
141 0.38
142 0.4
143 0.39
144 0.42
145 0.42
146 0.44
147 0.43
148 0.42
149 0.4
150 0.43
151 0.49
152 0.47
153 0.5
154 0.53
155 0.51
156 0.46
157 0.42
158 0.37
159 0.28
160 0.23
161 0.17
162 0.12
163 0.12
164 0.1