Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0XPX6

Protein Details
Accession F0XPX6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAGSWRRWRRWRGKRGVWAWDGHydrophilic
NLS Segment(s)
PositionSequence
9-14RRWRGK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MAGSWRRWRRWRGKRGVWAWDGIWATPKPLPDCFAYAPLPIGSMSNSSSESISSTTPVRMPRISSIRAVVPPKMITVSTTTTSTVALSAYVSLPVSSAASATPTAPRSPAQKSIAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.85
4 0.76
5 0.68
6 0.57
7 0.52
8 0.42
9 0.32
10 0.3
11 0.21
12 0.21
13 0.2
14 0.23
15 0.2
16 0.21
17 0.23
18 0.19
19 0.23
20 0.22
21 0.24
22 0.22
23 0.2
24 0.2
25 0.17
26 0.16
27 0.12
28 0.11
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.11
44 0.13
45 0.14
46 0.14
47 0.15
48 0.19
49 0.23
50 0.24
51 0.22
52 0.22
53 0.22
54 0.26
55 0.26
56 0.22
57 0.19
58 0.18
59 0.17
60 0.17
61 0.15
62 0.12
63 0.13
64 0.15
65 0.15
66 0.15
67 0.16
68 0.15
69 0.15
70 0.14
71 0.11
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.06
84 0.06
85 0.05
86 0.07
87 0.08
88 0.09
89 0.13
90 0.14
91 0.15
92 0.17
93 0.2
94 0.24
95 0.29
96 0.37