Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XM38

Protein Details
Accession F0XM38    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-25VWNSRPKKYGKGARSCRVCAHydrophilic
86-112ESNQKPRARPSLPRRSRKRAMAKGEFLHydrophilic
NLS Segment(s)
PositionSequence
90-108KPRARPSLPRRSRKRAMAK
Subcellular Location(s) nucl 11, cyto_nucl 10.833, mito_nucl 10.499, mito 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039744  40S_S29/30S_S14z  
IPR001209  Ribosomal_S14  
IPR043140  Ribosomal_S14/S29  
IPR018271  Ribosomal_S14_CS  
IPR023676  Ribosomal_S14_type-Z_arc  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0008270  F:zinc ion binding  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
PROSITE View protein in PROSITE  
PS00527  RIBOSOMAL_S14  
Amino Acid Sequences MSHESVWNSRPKKYGKGARSCRVCAHRAGLIRKYGLDICRQCFREKAADIGFVKVRTASRGSDKRWKQRCTCTDGSDSTGKCNKIESNQKPRARPSLPRRSRKRAMAKGEFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.72
4 0.77
5 0.79
6 0.81
7 0.75
8 0.73
9 0.68
10 0.61
11 0.53
12 0.47
13 0.42
14 0.42
15 0.45
16 0.41
17 0.39
18 0.37
19 0.34
20 0.32
21 0.31
22 0.26
23 0.28
24 0.28
25 0.28
26 0.34
27 0.36
28 0.35
29 0.33
30 0.34
31 0.33
32 0.3
33 0.31
34 0.25
35 0.29
36 0.28
37 0.28
38 0.27
39 0.2
40 0.2
41 0.16
42 0.15
43 0.12
44 0.13
45 0.12
46 0.19
47 0.24
48 0.29
49 0.37
50 0.44
51 0.53
52 0.61
53 0.65
54 0.63
55 0.68
56 0.69
57 0.68
58 0.66
59 0.59
60 0.54
61 0.5
62 0.48
63 0.43
64 0.37
65 0.35
66 0.35
67 0.32
68 0.28
69 0.29
70 0.28
71 0.31
72 0.41
73 0.45
74 0.51
75 0.6
76 0.66
77 0.69
78 0.72
79 0.72
80 0.67
81 0.68
82 0.67
83 0.69
84 0.73
85 0.79
86 0.83
87 0.83
88 0.87
89 0.87
90 0.87
91 0.86
92 0.86