Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XIF4

Protein Details
Accession F0XIF4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-52EDSQPKKVRKALRPWAPRKSLHydrophilic
NLS Segment(s)
PositionSequence
37-46KKVRKALRPW
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR041997  KOW_RPL6  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01159  Ribosomal_L6e  
PROSITE View protein in PROSITE  
PS01170  RIBOSOMAL_L6E  
CDD cd13156  KOW_RPL6  
Amino Acid Sequences MSAAPTTKKFGKSTRTVPHPSQRAQKWYAAEEDSQPKKVRKALRPWAPRKSLQPGTILILVAGRFRGKRVVLLKTLDQGLLLVTGPFKVNGVPLRRVNAKYVIATSEKVDLSGVDAKKIEEIAAPNYFTAEKAKEKASEEAFFKQGEKPQKKVVQATRAEDQKAIDKAIIANIKKVDLLSSYLATSFSLRKGDKPHEMKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.7
4 0.73
5 0.75
6 0.74
7 0.72
8 0.72
9 0.69
10 0.68
11 0.65
12 0.62
13 0.56
14 0.51
15 0.49
16 0.41
17 0.36
18 0.35
19 0.4
20 0.39
21 0.4
22 0.42
23 0.42
24 0.44
25 0.49
26 0.53
27 0.52
28 0.59
29 0.64
30 0.7
31 0.77
32 0.81
33 0.84
34 0.8
35 0.75
36 0.7
37 0.69
38 0.65
39 0.57
40 0.51
41 0.43
42 0.4
43 0.38
44 0.31
45 0.22
46 0.17
47 0.14
48 0.12
49 0.11
50 0.1
51 0.08
52 0.09
53 0.14
54 0.13
55 0.19
56 0.23
57 0.27
58 0.28
59 0.31
60 0.31
61 0.29
62 0.3
63 0.24
64 0.19
65 0.14
66 0.1
67 0.08
68 0.07
69 0.05
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.07
77 0.12
78 0.15
79 0.2
80 0.21
81 0.24
82 0.28
83 0.29
84 0.29
85 0.28
86 0.25
87 0.21
88 0.2
89 0.19
90 0.16
91 0.16
92 0.15
93 0.14
94 0.12
95 0.12
96 0.11
97 0.09
98 0.1
99 0.16
100 0.15
101 0.13
102 0.14
103 0.14
104 0.14
105 0.14
106 0.12
107 0.07
108 0.09
109 0.11
110 0.12
111 0.13
112 0.12
113 0.13
114 0.13
115 0.12
116 0.13
117 0.13
118 0.14
119 0.16
120 0.19
121 0.21
122 0.24
123 0.28
124 0.29
125 0.3
126 0.3
127 0.31
128 0.3
129 0.27
130 0.26
131 0.25
132 0.27
133 0.34
134 0.36
135 0.36
136 0.44
137 0.49
138 0.52
139 0.58
140 0.6
141 0.59
142 0.59
143 0.6
144 0.58
145 0.56
146 0.53
147 0.45
148 0.39
149 0.36
150 0.33
151 0.29
152 0.22
153 0.19
154 0.19
155 0.23
156 0.29
157 0.23
158 0.25
159 0.25
160 0.25
161 0.25
162 0.24
163 0.2
164 0.14
165 0.17
166 0.16
167 0.16
168 0.16
169 0.16
170 0.16
171 0.15
172 0.16
173 0.15
174 0.16
175 0.22
176 0.23
177 0.27
178 0.35
179 0.42
180 0.5