Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0XH68

Protein Details
Accession F0XH68    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
257-281DSLPPAKTPSRRKRTKVDELVRAKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001737  KsgA/Erm  
IPR020598  rRNA_Ade_methylase_Trfase_N  
IPR011530  rRNA_adenine_dimethylase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0052909  F:18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00398  RrnaAD  
PROSITE View protein in PROSITE  
PS51689  SAM_RNA_A_N6_MT  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGKAKAPRRTGAASASSPYARPTTGKAGTKKNNVFKFNTNVGQALQMCGKSRRTGNITTRILEKARKCIAIELDPRMAAEVTKRVQGGPLQKKLEVLLGDAIKTEFPPFDVCISNTPYQISSPLVFKLLSLPNPPRTAVLMFQKEFAQRLVARPGDTLYCRLSVNAQFFARIAHVLKVGKANFNPPPQVESAVVRITPKTGSERPKFNFSEMDGMLRVAFNRKNRTMRASFASKEVLAMLARNYRVYASINGIALDDSLPPAKTPSRRKRTKVDELVRAKVLRVLERLEMADRRSRQCDEGDFLRLLDAMNSEGIRFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.35
4 0.31
5 0.3
6 0.26
7 0.21
8 0.2
9 0.23
10 0.28
11 0.35
12 0.42
13 0.46
14 0.54
15 0.62
16 0.71
17 0.75
18 0.75
19 0.76
20 0.74
21 0.72
22 0.68
23 0.67
24 0.63
25 0.58
26 0.5
27 0.43
28 0.38
29 0.38
30 0.32
31 0.27
32 0.23
33 0.2
34 0.22
35 0.25
36 0.27
37 0.27
38 0.3
39 0.35
40 0.37
41 0.45
42 0.5
43 0.56
44 0.56
45 0.53
46 0.53
47 0.49
48 0.47
49 0.45
50 0.4
51 0.39
52 0.4
53 0.41
54 0.39
55 0.4
56 0.41
57 0.42
58 0.44
59 0.39
60 0.37
61 0.34
62 0.33
63 0.29
64 0.25
65 0.17
66 0.15
67 0.16
68 0.15
69 0.18
70 0.19
71 0.18
72 0.2
73 0.24
74 0.32
75 0.35
76 0.41
77 0.41
78 0.41
79 0.41
80 0.4
81 0.39
82 0.29
83 0.21
84 0.18
85 0.16
86 0.15
87 0.15
88 0.15
89 0.11
90 0.11
91 0.11
92 0.06
93 0.07
94 0.09
95 0.09
96 0.12
97 0.13
98 0.13
99 0.16
100 0.21
101 0.21
102 0.2
103 0.2
104 0.18
105 0.17
106 0.17
107 0.16
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.11
114 0.15
115 0.16
116 0.17
117 0.2
118 0.23
119 0.27
120 0.28
121 0.28
122 0.24
123 0.23
124 0.22
125 0.21
126 0.24
127 0.25
128 0.24
129 0.25
130 0.26
131 0.25
132 0.24
133 0.21
134 0.18
135 0.13
136 0.15
137 0.19
138 0.18
139 0.18
140 0.17
141 0.18
142 0.16
143 0.16
144 0.16
145 0.12
146 0.12
147 0.12
148 0.12
149 0.14
150 0.15
151 0.17
152 0.18
153 0.17
154 0.15
155 0.15
156 0.16
157 0.14
158 0.12
159 0.1
160 0.08
161 0.11
162 0.11
163 0.12
164 0.16
165 0.16
166 0.18
167 0.18
168 0.21
169 0.24
170 0.26
171 0.27
172 0.23
173 0.25
174 0.23
175 0.24
176 0.21
177 0.17
178 0.17
179 0.16
180 0.16
181 0.14
182 0.13
183 0.12
184 0.11
185 0.12
186 0.16
187 0.21
188 0.29
189 0.34
190 0.42
191 0.44
192 0.51
193 0.51
194 0.46
195 0.43
196 0.35
197 0.37
198 0.29
199 0.28
200 0.2
201 0.19
202 0.17
203 0.15
204 0.14
205 0.12
206 0.16
207 0.21
208 0.28
209 0.34
210 0.4
211 0.43
212 0.51
213 0.49
214 0.49
215 0.49
216 0.47
217 0.42
218 0.39
219 0.38
220 0.3
221 0.27
222 0.23
223 0.18
224 0.12
225 0.12
226 0.12
227 0.14
228 0.14
229 0.14
230 0.14
231 0.13
232 0.15
233 0.17
234 0.16
235 0.16
236 0.18
237 0.18
238 0.18
239 0.18
240 0.16
241 0.14
242 0.12
243 0.08
244 0.07
245 0.08
246 0.08
247 0.08
248 0.12
249 0.17
250 0.25
251 0.36
252 0.46
253 0.56
254 0.65
255 0.72
256 0.79
257 0.84
258 0.86
259 0.86
260 0.84
261 0.83
262 0.8
263 0.79
264 0.73
265 0.64
266 0.53
267 0.45
268 0.4
269 0.34
270 0.3
271 0.28
272 0.25
273 0.26
274 0.28
275 0.29
276 0.29
277 0.28
278 0.33
279 0.35
280 0.39
281 0.42
282 0.44
283 0.42
284 0.44
285 0.46
286 0.44
287 0.42
288 0.42
289 0.37
290 0.34
291 0.31
292 0.27
293 0.22
294 0.17
295 0.13
296 0.1
297 0.12
298 0.12