FuNGI

C4Y3W4

Protein Details

Accession

C4Y3W4

Localization Confidence

Low

Confidence Score

9.2

NoLS Segment(s)

Position	Sequence	Protein Nature
45-64	KPFQCFPSLKQRKPTYSRFD	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 15.5, cyto_nucl 12, cyto 5.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR029149 Creatin/AminoP/Spt16_NTD IPR036005 Creatinase/aminopeptidase-like IPR000587 Creatinase_N IPR000994 Pept_M24
Gene Ontology	GO:0016787 F:hydrolase activity
KEGG	clu:CLUG_02336 -
Pfam	View protein in Pfam PF01321 Creatinase_N PF16189 Creatinase_N_2 PF00557 Peptidase_M24

Amino Acid Sequences

MALSSHKPAGKFLILKPQMEKEPLLGSEESQQGEEAASFLKFLSKPFQCFPSLKQRKPTYSRFDIAMSESQPSDFDQLPDLPWSNVKVTSSLSTSEKLEKIRRLMKEHSIAVYLVPSEDEHQSEETALSDKRREFLSGFTGSAGICVVTLDDPSTLEGEAALSTDGRYFLQAEKQLDLKYWRLLKQGAAGYPSWQKFAIEKAAKSKVSNVISCDPKFLSLAWGEYFEQNSKSAGALFKPLAGTNLVDIVWGSEKPPRTMDPVYHLPLEYSGERTEAKLARVRDHLKEVGATHIVISALDDIGWLLNLRADTDIPFSPFFFSYVIVSLTDVTLYAQKEKLVNVDEYLKSIQGLSVKSYDSFYPDLGKFKASIHDPNLKLILPSKDACNYALVSALPQSITKRTIVFDSVVATMKLFKNRTELMNAKIAQTKDSLAFIIFSSWLEHQLIYKKAEINEYEAAQKIYSIRSKFPHFKGLSYETISSSGPNAAIIHYAPSAEQHDVIDPKVLPYLIDSGGHYLEVVDRYHENI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.44
2	0.47
3	0.49
4	0.5
5	0.47
6	0.46
7	0.43
8	0.35
9	0.35
10	0.33
11	0.33
12	0.27
13	0.23
14	0.26
15	0.29
16	0.27
17	0.22
18	0.22
19	0.18
20	0.18
21	0.17
22	0.11
23	0.09
24	0.08
25	0.08
26	0.08
27	0.13
28	0.13
29	0.15
30	0.24
31	0.28
32	0.33
33	0.36
34	0.41
35	0.4
36	0.42
37	0.46
38	0.48
39	0.54
40	0.54
41	0.61
42	0.66
43	0.71
44	0.76
45	0.8
46	0.78
47	0.75
48	0.72
49	0.65
50	0.58
51	0.5
52	0.46
53	0.41
54	0.33
55	0.27
56	0.24
57	0.22
58	0.2
59	0.2
60	0.19
61	0.16
62	0.15
63	0.16
64	0.17
65	0.18
66	0.21
67	0.21
68	0.18
69	0.19
70	0.21
71	0.2
72	0.21
73	0.2
74	0.18
75	0.19
76	0.2
77	0.2
78	0.21
79	0.21
80	0.21
81	0.23
82	0.27
83	0.28
84	0.31
85	0.37
86	0.39
87	0.44
88	0.5
89	0.53
90	0.54
91	0.57
92	0.59
93	0.59
94	0.56
95	0.5
96	0.44
97	0.38
98	0.32
99	0.27
100	0.19
101	0.12
102	0.1
103	0.09
104	0.09
105	0.11
106	0.11
107	0.12
108	0.13
109	0.13
110	0.13
111	0.13
112	0.11
113	0.12
114	0.13
115	0.14
116	0.18
117	0.18
118	0.2
119	0.21
120	0.22
121	0.2
122	0.22
123	0.26
124	0.23
125	0.23
126	0.21
127	0.2
128	0.18
129	0.17
130	0.14
131	0.07
132	0.05
133	0.04
134	0.05
135	0.04
136	0.05
137	0.05
138	0.05
139	0.06
140	0.06
141	0.07
142	0.07
143	0.06
144	0.06
145	0.06
146	0.05
147	0.05
148	0.05
149	0.04
150	0.05
151	0.05
152	0.06
153	0.06
154	0.07
155	0.08
156	0.09
157	0.14
158	0.19
159	0.2
160	0.21
161	0.23
162	0.23
163	0.24
164	0.25
165	0.22
166	0.23
167	0.26
168	0.27
169	0.28
170	0.29
171	0.28
172	0.31
173	0.32
174	0.27
175	0.25
176	0.23
177	0.22
178	0.28
179	0.27
180	0.22
181	0.19
182	0.18
183	0.17
184	0.2
185	0.27
186	0.23
187	0.24
188	0.29
189	0.35
190	0.36
191	0.35
192	0.36
193	0.34
194	0.35
195	0.35
196	0.32
197	0.32
198	0.37
199	0.37
200	0.35
201	0.27
202	0.25
203	0.23
204	0.2
205	0.16
206	0.11
207	0.12
208	0.11
209	0.12
210	0.13
211	0.13
212	0.14
213	0.12
214	0.13
215	0.12
216	0.12
217	0.1
218	0.09
219	0.1
220	0.1
221	0.09
222	0.11
223	0.1
224	0.11
225	0.11
226	0.11
227	0.1
228	0.1
229	0.1
230	0.07
231	0.08
232	0.07
233	0.06
234	0.06
235	0.06
236	0.06
237	0.06
238	0.06
239	0.08
240	0.1
241	0.11
242	0.13
243	0.14
244	0.18
245	0.19
246	0.19
247	0.23
248	0.26
249	0.27
250	0.26
251	0.25
252	0.2
253	0.19
254	0.2
255	0.14
256	0.11
257	0.09
258	0.1
259	0.1
260	0.11
261	0.15
262	0.14
263	0.16
264	0.18
265	0.19
266	0.21
267	0.27
268	0.3
269	0.27
270	0.3
271	0.29
272	0.25
273	0.26
274	0.23
275	0.19
276	0.17
277	0.14
278	0.1
279	0.1
280	0.09
281	0.07
282	0.07
283	0.05
284	0.04
285	0.04
286	0.04
287	0.03
288	0.03
289	0.03
290	0.03
291	0.03
292	0.04
293	0.04
294	0.05
295	0.05
296	0.06
297	0.07
298	0.09
299	0.1
300	0.11
301	0.12
302	0.11
303	0.13
304	0.13
305	0.13
306	0.1
307	0.1
308	0.09
309	0.1
310	0.1
311	0.08
312	0.08
313	0.08
314	0.07
315	0.06
316	0.06
317	0.05
318	0.08
319	0.08
320	0.1
321	0.11
322	0.12
323	0.13
324	0.14
325	0.16
326	0.16
327	0.16
328	0.15
329	0.2
330	0.18
331	0.2
332	0.2
333	0.17
334	0.14
335	0.13
336	0.13
337	0.12
338	0.12
339	0.12
340	0.13
341	0.14
342	0.14
343	0.16
344	0.15
345	0.15
346	0.15
347	0.14
348	0.17
349	0.18
350	0.21
351	0.2
352	0.21
353	0.18
354	0.19
355	0.23
356	0.2
357	0.25
358	0.27
359	0.35
360	0.35
361	0.36
362	0.37
363	0.32
364	0.29
365	0.29
366	0.26
367	0.21
368	0.22
369	0.22
370	0.24
371	0.25
372	0.25
373	0.22
374	0.19
375	0.16
376	0.16
377	0.13
378	0.11
379	0.11
380	0.11
381	0.09
382	0.1
383	0.12
384	0.13
385	0.15
386	0.16
387	0.16
388	0.17
389	0.19
390	0.2
391	0.19
392	0.16
393	0.17
394	0.17
395	0.17
396	0.16
397	0.14
398	0.16
399	0.18
400	0.24
401	0.24
402	0.23
403	0.28
404	0.31
405	0.33
406	0.36
407	0.37
408	0.34
409	0.4
410	0.4
411	0.36
412	0.39
413	0.36
414	0.3
415	0.28
416	0.26
417	0.2
418	0.2
419	0.18
420	0.13
421	0.13
422	0.12
423	0.12
424	0.1
425	0.09
426	0.11
427	0.11
428	0.13
429	0.13
430	0.13
431	0.15
432	0.22
433	0.25
434	0.25
435	0.29
436	0.3
437	0.31
438	0.37
439	0.35
440	0.34
441	0.33
442	0.32
443	0.31
444	0.28
445	0.27
446	0.21
447	0.21
448	0.18
449	0.2
450	0.26
451	0.26
452	0.3
453	0.35
454	0.44
455	0.52
456	0.54
457	0.58
458	0.53
459	0.53
460	0.55
461	0.54
462	0.51
463	0.46
464	0.44
465	0.34
466	0.35
467	0.33
468	0.25
469	0.21
470	0.18
471	0.14
472	0.13
473	0.12
474	0.11
475	0.12
476	0.12
477	0.13
478	0.12
479	0.12
480	0.11
481	0.13
482	0.16
483	0.16
484	0.16
485	0.15
486	0.2
487	0.22
488	0.22
489	0.24
490	0.21
491	0.21
492	0.23
493	0.21
494	0.16
495	0.17
496	0.2
497	0.17
498	0.18
499	0.18
500	0.18
501	0.18
502	0.18
503	0.16
504	0.12
505	0.14
506	0.15
507	0.15
508	0.15

C4Y3W4

3D AlphaFold-predicted Structure Viewer