Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y3W4

Protein Details
Accession C4Y3W4   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-64KPFQCFPSLKQRKPTYSRFDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029149  Creatin/AminoP/Spt16_NTD  
IPR036005  Creatinase/aminopeptidase-like  
IPR000587  Creatinase_N  
IPR000994  Pept_M24  
Gene Ontology GO:0016787  F:hydrolase activity  
KEGG clu:CLUG_02336  -  
Pfam View protein in Pfam  
PF01321  Creatinase_N  
PF16189  Creatinase_N_2  
PF00557  Peptidase_M24  
Amino Acid Sequences MALSSHKPAGKFLILKPQMEKEPLLGSEESQQGEEAASFLKFLSKPFQCFPSLKQRKPTYSRFDIAMSESQPSDFDQLPDLPWSNVKVTSSLSTSEKLEKIRRLMKEHSIAVYLVPSEDEHQSEETALSDKRREFLSGFTGSAGICVVTLDDPSTLEGEAALSTDGRYFLQAEKQLDLKYWRLLKQGAAGYPSWQKFAIEKAAKSKVSNVISCDPKFLSLAWGEYFEQNSKSAGALFKPLAGTNLVDIVWGSEKPPRTMDPVYHLPLEYSGERTEAKLARVRDHLKEVGATHIVISALDDIGWLLNLRADTDIPFSPFFFSYVIVSLTDVTLYAQKEKLVNVDEYLKSIQGLSVKSYDSFYPDLGKFKASIHDPNLKLILPSKDACNYALVSALPQSITKRTIVFDSVVATMKLFKNRTELMNAKIAQTKDSLAFIIFSSWLEHQLIYKKAEINEYEAAQKIYSIRSKFPHFKGLSYETISSSGPNAAIIHYAPSAEQHDVIDPKVLPYLIDSGGHYLEVVDRYHENI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.5
5 0.47
6 0.46
7 0.43
8 0.35
9 0.35
10 0.33
11 0.33
12 0.27
13 0.23
14 0.26
15 0.29
16 0.27
17 0.22
18 0.22
19 0.18
20 0.18
21 0.17
22 0.11
23 0.09
24 0.08
25 0.08
26 0.08
27 0.13
28 0.13
29 0.15
30 0.24
31 0.28
32 0.33
33 0.36
34 0.41
35 0.4
36 0.42
37 0.46
38 0.48
39 0.54
40 0.54
41 0.61
42 0.66
43 0.71
44 0.76
45 0.8
46 0.78
47 0.75
48 0.72
49 0.65
50 0.58
51 0.5
52 0.46
53 0.41
54 0.33
55 0.27
56 0.24
57 0.22
58 0.2
59 0.2
60 0.19
61 0.16
62 0.15
63 0.16
64 0.17
65 0.18
66 0.21
67 0.21
68 0.18
69 0.19
70 0.21
71 0.2
72 0.21
73 0.2
74 0.18
75 0.19
76 0.2
77 0.2
78 0.21
79 0.21
80 0.21
81 0.23
82 0.27
83 0.28
84 0.31
85 0.37
86 0.39
87 0.44
88 0.5
89 0.53
90 0.54
91 0.57
92 0.59
93 0.59
94 0.56
95 0.5
96 0.44
97 0.38
98 0.32
99 0.27
100 0.19
101 0.12
102 0.1
103 0.09
104 0.09
105 0.11
106 0.11
107 0.12
108 0.13
109 0.13
110 0.13
111 0.13
112 0.11
113 0.12
114 0.13
115 0.14
116 0.18
117 0.18
118 0.2
119 0.21
120 0.22
121 0.2
122 0.22
123 0.26
124 0.23
125 0.23
126 0.21
127 0.2
128 0.18
129 0.17
130 0.14
131 0.07
132 0.05
133 0.04
134 0.05
135 0.04
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.04
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.08
156 0.09
157 0.14
158 0.19
159 0.2
160 0.21
161 0.23
162 0.23
163 0.24
164 0.25
165 0.22
166 0.23
167 0.26
168 0.27
169 0.28
170 0.29
171 0.28
172 0.31
173 0.32
174 0.27
175 0.25
176 0.23
177 0.22
178 0.28
179 0.27
180 0.22
181 0.19
182 0.18
183 0.17
184 0.2
185 0.27
186 0.23
187 0.24
188 0.29
189 0.35
190 0.36
191 0.35
192 0.36
193 0.34
194 0.35
195 0.35
196 0.32
197 0.32
198 0.37
199 0.37
200 0.35
201 0.27
202 0.25
203 0.23
204 0.2
205 0.16
206 0.11
207 0.12
208 0.11
209 0.12
210 0.13
211 0.13
212 0.14
213 0.12
214 0.13
215 0.12
216 0.12
217 0.1
218 0.09
219 0.1
220 0.1
221 0.09
222 0.11
223 0.1
224 0.11
225 0.11
226 0.11
227 0.1
228 0.1
229 0.1
230 0.07
231 0.08
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.08
240 0.1
241 0.11
242 0.13
243 0.14
244 0.18
245 0.19
246 0.19
247 0.23
248 0.26
249 0.27
250 0.26
251 0.25
252 0.2
253 0.19
254 0.2
255 0.14
256 0.11
257 0.09
258 0.1
259 0.1
260 0.11
261 0.15
262 0.14
263 0.16
264 0.18
265 0.19
266 0.21
267 0.27
268 0.3
269 0.27
270 0.3
271 0.29
272 0.25
273 0.26
274 0.23
275 0.19
276 0.17
277 0.14
278 0.1
279 0.1
280 0.09
281 0.07
282 0.07
283 0.05
284 0.04
285 0.04
286 0.04
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.04
293 0.04
294 0.05
295 0.05
296 0.06
297 0.07
298 0.09
299 0.1
300 0.11
301 0.12
302 0.11
303 0.13
304 0.13
305 0.13
306 0.1
307 0.1
308 0.09
309 0.1
310 0.1
311 0.08
312 0.08
313 0.08
314 0.07
315 0.06
316 0.06
317 0.05
318 0.08
319 0.08
320 0.1
321 0.11
322 0.12
323 0.13
324 0.14
325 0.16
326 0.16
327 0.16
328 0.15
329 0.2
330 0.18
331 0.2
332 0.2
333 0.17
334 0.14
335 0.13
336 0.13
337 0.12
338 0.12
339 0.12
340 0.13
341 0.14
342 0.14
343 0.16
344 0.15
345 0.15
346 0.15
347 0.14
348 0.17
349 0.18
350 0.21
351 0.2
352 0.21
353 0.18
354 0.19
355 0.23
356 0.2
357 0.25
358 0.27
359 0.35
360 0.35
361 0.36
362 0.37
363 0.32
364 0.29
365 0.29
366 0.26
367 0.21
368 0.22
369 0.22
370 0.24
371 0.25
372 0.25
373 0.22
374 0.19
375 0.16
376 0.16
377 0.13
378 0.11
379 0.11
380 0.11
381 0.09
382 0.1
383 0.12
384 0.13
385 0.15
386 0.16
387 0.16
388 0.17
389 0.19
390 0.2
391 0.19
392 0.16
393 0.17
394 0.17
395 0.17
396 0.16
397 0.14
398 0.16
399 0.18
400 0.24
401 0.24
402 0.23
403 0.28
404 0.31
405 0.33
406 0.36
407 0.37
408 0.34
409 0.4
410 0.4
411 0.36
412 0.39
413 0.36
414 0.3
415 0.28
416 0.26
417 0.2
418 0.2
419 0.18
420 0.13
421 0.13
422 0.12
423 0.12
424 0.1
425 0.09
426 0.11
427 0.11
428 0.13
429 0.13
430 0.13
431 0.15
432 0.22
433 0.25
434 0.25
435 0.29
436 0.3
437 0.31
438 0.37
439 0.35
440 0.34
441 0.33
442 0.32
443 0.31
444 0.28
445 0.27
446 0.21
447 0.21
448 0.18
449 0.2
450 0.26
451 0.26
452 0.3
453 0.35
454 0.44
455 0.52
456 0.54
457 0.58
458 0.53
459 0.53
460 0.55
461 0.54
462 0.51
463 0.46
464 0.44
465 0.34
466 0.35
467 0.33
468 0.25
469 0.21
470 0.18
471 0.14
472 0.13
473 0.12
474 0.11
475 0.12
476 0.12
477 0.13
478 0.12
479 0.12
480 0.11
481 0.13
482 0.16
483 0.16
484 0.16
485 0.15
486 0.2
487 0.22
488 0.22
489 0.24
490 0.21
491 0.21
492 0.23
493 0.21
494 0.16
495 0.17
496 0.2
497 0.17
498 0.18
499 0.18
500 0.18
501 0.18
502 0.18
503 0.16
504 0.12
505 0.14
506 0.15
507 0.15
508 0.15