Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0UU26

Protein Details
Accession Q0UU26    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-27MDIDFTRRNKKPRPLSEHEKEKLBasic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0000307  C:cyclin-dependent protein kinase holoenzyme complex  
GO:0019005  C:SCF ubiquitin ligase complex  
GO:0061575  F:cyclin-dependent protein serine/threonine kinase activator activity  
GO:0042393  F:histone binding  
GO:0019901  F:protein kinase binding  
GO:0043130  F:ubiquitin binding  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0007346  P:regulation of mitotic cell cycle  
KEGG pno:SNOG_04738  -  
Pfam View protein in Pfam  
PF01111  CKS  
PROSITE View protein in PROSITE  
PS00945  CKS_2  
Amino Acid Sequences MTGGMDIDFTRRNKKPRPLSEHEKEKLDEFVDAIHYSARYSDDENEYRHVQLPKQMLKVIPKDYFDSRGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFKRPINYQPPMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.73
4 0.8
5 0.8
6 0.84
7 0.85
8 0.86
9 0.79
10 0.73
11 0.63
12 0.55
13 0.48
14 0.39
15 0.29
16 0.19
17 0.16
18 0.14
19 0.13
20 0.11
21 0.1
22 0.09
23 0.09
24 0.09
25 0.1
26 0.09
27 0.11
28 0.14
29 0.18
30 0.21
31 0.23
32 0.25
33 0.25
34 0.24
35 0.27
36 0.25
37 0.2
38 0.23
39 0.28
40 0.28
41 0.29
42 0.29
43 0.27
44 0.3
45 0.33
46 0.33
47 0.28
48 0.26
49 0.27
50 0.27
51 0.3
52 0.26
53 0.24
54 0.21
55 0.22
56 0.21
57 0.19
58 0.18
59 0.16
60 0.16
61 0.15
62 0.16
63 0.15
64 0.14
65 0.15
66 0.14
67 0.12
68 0.11
69 0.09
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.15
81 0.16
82 0.18
83 0.21
84 0.21
85 0.22
86 0.24
87 0.22
88 0.19
89 0.19
90 0.21
91 0.25
92 0.29
93 0.31
94 0.32
95 0.38
96 0.42