Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4YCH2

Protein Details
Accession C4YCH2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-140VEDPRKSGTKWEQKRKGVKEHGRRNQKEQRRSGHPKKFAEBasic
NLS Segment(s)
PositionSequence
105-137RKSGTKWEQKRKGVKEHGRRNQKEQRRSGHPKK
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR014842  AFT  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0036086  P:positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation  
KEGG clu:CLUG_05811  -  
Pfam View protein in Pfam  
PF08731  AFT  
Amino Acid Sequences MLQKKSANIQPQKSMFRATVDVSATFSHKSDIKPWLQSQVAAFQFAVAIERSDHVKIVFRCKSGSASCPFRLRANYSVRSGRWSLVSMCDLHDHRVGGPEVEDPRKSGTKWEQKRKGVKEHGRRNQKEQRRSGHPKKFAEASFVSERPDRGYSESAYEKTYGAERIYDRSADRNLERHSDDRSSSDRHLLSGNLLADRNLLSDRNSLGNLSERSVLTEKNFLSEKNLLSERSLLPERNPTERGVSDRQDTIRPDLDPSVDSVVRRTVSQFTQLVQRHIWQNQALPPDQKEAAVARVVAELVDEYLGDTRAPAATHTMPLSPLLNEDASAPQLPGLDGPSRGSGPLPPFTQLQKRLPLSPAPDGKTLNPVQLMKTADLREFKVDNLGSVSFASPQDRADLVGLANLSYSWASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.51
3 0.46
4 0.43
5 0.36
6 0.34
7 0.3
8 0.29
9 0.26
10 0.26
11 0.24
12 0.22
13 0.2
14 0.18
15 0.2
16 0.22
17 0.26
18 0.33
19 0.37
20 0.43
21 0.45
22 0.49
23 0.47
24 0.46
25 0.42
26 0.42
27 0.37
28 0.31
29 0.29
30 0.21
31 0.2
32 0.18
33 0.18
34 0.09
35 0.09
36 0.09
37 0.1
38 0.13
39 0.13
40 0.15
41 0.14
42 0.21
43 0.24
44 0.33
45 0.37
46 0.36
47 0.37
48 0.38
49 0.42
50 0.38
51 0.42
52 0.38
53 0.4
54 0.44
55 0.48
56 0.48
57 0.47
58 0.48
59 0.46
60 0.47
61 0.49
62 0.49
63 0.49
64 0.54
65 0.49
66 0.5
67 0.46
68 0.4
69 0.33
70 0.31
71 0.27
72 0.24
73 0.25
74 0.21
75 0.2
76 0.24
77 0.23
78 0.24
79 0.24
80 0.21
81 0.2
82 0.24
83 0.23
84 0.18
85 0.18
86 0.19
87 0.22
88 0.25
89 0.24
90 0.21
91 0.25
92 0.27
93 0.27
94 0.3
95 0.36
96 0.43
97 0.53
98 0.63
99 0.68
100 0.74
101 0.84
102 0.83
103 0.83
104 0.83
105 0.83
106 0.83
107 0.84
108 0.85
109 0.86
110 0.82
111 0.82
112 0.81
113 0.81
114 0.8
115 0.77
116 0.75
117 0.75
118 0.82
119 0.82
120 0.82
121 0.81
122 0.74
123 0.7
124 0.68
125 0.58
126 0.53
127 0.44
128 0.4
129 0.36
130 0.33
131 0.32
132 0.27
133 0.27
134 0.24
135 0.25
136 0.2
137 0.19
138 0.2
139 0.19
140 0.22
141 0.24
142 0.22
143 0.22
144 0.21
145 0.18
146 0.16
147 0.17
148 0.15
149 0.12
150 0.14
151 0.14
152 0.16
153 0.17
154 0.18
155 0.17
156 0.19
157 0.2
158 0.21
159 0.22
160 0.24
161 0.25
162 0.27
163 0.29
164 0.27
165 0.28
166 0.27
167 0.26
168 0.24
169 0.25
170 0.25
171 0.24
172 0.28
173 0.24
174 0.23
175 0.23
176 0.19
177 0.17
178 0.16
179 0.16
180 0.12
181 0.11
182 0.11
183 0.1
184 0.1
185 0.1
186 0.07
187 0.07
188 0.07
189 0.09
190 0.1
191 0.11
192 0.11
193 0.1
194 0.1
195 0.14
196 0.13
197 0.13
198 0.14
199 0.12
200 0.15
201 0.16
202 0.16
203 0.13
204 0.17
205 0.16
206 0.16
207 0.17
208 0.14
209 0.18
210 0.2
211 0.19
212 0.19
213 0.2
214 0.18
215 0.18
216 0.21
217 0.17
218 0.19
219 0.2
220 0.17
221 0.17
222 0.24
223 0.26
224 0.27
225 0.28
226 0.25
227 0.26
228 0.27
229 0.31
230 0.28
231 0.28
232 0.26
233 0.28
234 0.28
235 0.29
236 0.29
237 0.28
238 0.25
239 0.23
240 0.23
241 0.21
242 0.2
243 0.17
244 0.16
245 0.16
246 0.15
247 0.14
248 0.14
249 0.16
250 0.15
251 0.15
252 0.16
253 0.16
254 0.16
255 0.21
256 0.21
257 0.19
258 0.27
259 0.29
260 0.3
261 0.27
262 0.3
263 0.3
264 0.3
265 0.33
266 0.25
267 0.27
268 0.28
269 0.31
270 0.3
271 0.27
272 0.28
273 0.28
274 0.27
275 0.23
276 0.21
277 0.18
278 0.18
279 0.16
280 0.14
281 0.11
282 0.11
283 0.11
284 0.09
285 0.08
286 0.06
287 0.05
288 0.05
289 0.04
290 0.04
291 0.05
292 0.06
293 0.05
294 0.05
295 0.06
296 0.07
297 0.07
298 0.08
299 0.11
300 0.12
301 0.15
302 0.16
303 0.16
304 0.15
305 0.16
306 0.17
307 0.12
308 0.12
309 0.13
310 0.12
311 0.11
312 0.12
313 0.12
314 0.13
315 0.13
316 0.12
317 0.1
318 0.11
319 0.1
320 0.1
321 0.11
322 0.12
323 0.12
324 0.14
325 0.15
326 0.15
327 0.16
328 0.16
329 0.17
330 0.19
331 0.24
332 0.23
333 0.23
334 0.26
335 0.31
336 0.39
337 0.42
338 0.44
339 0.48
340 0.49
341 0.51
342 0.52
343 0.52
344 0.48
345 0.5
346 0.51
347 0.46
348 0.47
349 0.45
350 0.43
351 0.46
352 0.42
353 0.37
354 0.35
355 0.32
356 0.3
357 0.33
358 0.34
359 0.28
360 0.33
361 0.31
362 0.31
363 0.33
364 0.34
365 0.34
366 0.32
367 0.31
368 0.33
369 0.31
370 0.27
371 0.27
372 0.25
373 0.2
374 0.21
375 0.21
376 0.16
377 0.17
378 0.18
379 0.16
380 0.16
381 0.18
382 0.17
383 0.18
384 0.17
385 0.17
386 0.14
387 0.16
388 0.15
389 0.12
390 0.12
391 0.1
392 0.1