Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y5P1

Protein Details
Accession C4Y5P1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-157IIAARPTYKAQLKKKQKKQRTWFHydrophilic
NLS Segment(s)
PositionSequence
147-152KKKQKK
Subcellular Location(s) mito 15.5, mito_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG clu:CLUG_03475  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSLSAKEAFAKLPQKLHNFFIKYPPRPFAKYAEKPSTVNDPHMNPFLPNKNTDSGRWHGAKYSLRRSADLFKMARKFGIQDLLPPIPHRKFYEDKYYQKNWMRGVLNQKKQKWERELPEKLKNREEALAKMDETIIAARPTYKAQLKKKQKKQRTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.52
4 0.54
5 0.52
6 0.5
7 0.54
8 0.56
9 0.55
10 0.57
11 0.58
12 0.55
13 0.54
14 0.55
15 0.53
16 0.54
17 0.56
18 0.61
19 0.62
20 0.59
21 0.56
22 0.57
23 0.57
24 0.48
25 0.44
26 0.39
27 0.34
28 0.35
29 0.36
30 0.34
31 0.26
32 0.3
33 0.32
34 0.3
35 0.29
36 0.29
37 0.31
38 0.33
39 0.33
40 0.33
41 0.28
42 0.32
43 0.32
44 0.29
45 0.26
46 0.29
47 0.34
48 0.34
49 0.39
50 0.41
51 0.4
52 0.4
53 0.41
54 0.42
55 0.39
56 0.38
57 0.31
58 0.29
59 0.32
60 0.31
61 0.28
62 0.23
63 0.21
64 0.16
65 0.19
66 0.14
67 0.13
68 0.17
69 0.18
70 0.18
71 0.18
72 0.22
73 0.18
74 0.22
75 0.21
76 0.23
77 0.26
78 0.3
79 0.39
80 0.42
81 0.47
82 0.52
83 0.53
84 0.56
85 0.58
86 0.59
87 0.5
88 0.49
89 0.44
90 0.41
91 0.49
92 0.51
93 0.54
94 0.57
95 0.59
96 0.62
97 0.66
98 0.7
99 0.67
100 0.66
101 0.67
102 0.69
103 0.76
104 0.73
105 0.77
106 0.77
107 0.74
108 0.7
109 0.64
110 0.57
111 0.52
112 0.48
113 0.42
114 0.37
115 0.35
116 0.29
117 0.26
118 0.24
119 0.18
120 0.16
121 0.14
122 0.12
123 0.1
124 0.1
125 0.11
126 0.12
127 0.15
128 0.21
129 0.27
130 0.34
131 0.44
132 0.55
133 0.66
134 0.75
135 0.84
136 0.88
137 0.91