Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y4C6

Protein Details
Accession C4Y4C6    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKSKNHTNHNQTKKAHKNGIKKPKTYHydrophilic
NLS Segment(s)
PositionSequence
14-30KKAHKNGIKKPKTYRYR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG clu:CLUG_02498  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQTKKAHKNGIKKPKTYRYRSLRNVDSKFRRNHRYALRGTAKALAAAKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.75
5 0.75
6 0.77
7 0.84
8 0.8
9 0.76
10 0.76
11 0.77
12 0.79
13 0.76
14 0.75
15 0.73
16 0.76
17 0.77
18 0.76
19 0.73
20 0.73
21 0.7
22 0.69
23 0.69
24 0.67
25 0.67
26 0.67
27 0.68
28 0.62
29 0.66
30 0.66
31 0.67
32 0.62
33 0.65
34 0.64
35 0.58
36 0.56
37 0.52
38 0.43
39 0.38
40 0.36