Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y1U2

Protein Details
Accession C4Y1U2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
236-255LYPPEKDKAKKMKKEPNEFDBasic
NLS Segment(s)
PositionSequence
293-295KKR
Subcellular Location(s) nucl 16, cyto_nucl 15.5, cyto 9
Family & Domain DBs
KEGG clu:CLUG_02174  -  
Amino Acid Sequences MSGPSTSNERSTGQGLAPQHQHLQQQHLHHQQQLDHTTAAAIALANGHDFPNPAAVMGHHDDESQYHRGVHMSAAAAAQMQQQQMQQQHLQQQHLQHQHLQHQHLQQHPLQQQHHLQQQLHQQQLHRQQLPQHQHAMTLPTAGIDYENGGFLVSRHGEGDIIKTFSSKQDLVKYVKTVLNEEEQCKIVINSSKPKAVYFQCERSGSFRTTVKDATKRQRVAYTKRSKCGYRLVANLYPPEKDKAKKMKKEPNEFDGTYHDDDKKDSEMWILRMIHPAHNHPPEPNFATVGGKKKRAKYTRTLVEKPLHRNGGAAAAAAAAAAVGYQPELLDHHHLQAQQYQHLQAQHQQQLHHQHLQHAQHLQHAQHHHEDNHPSVQDVAVIAAMEAAPGNGGLSNPPVDPSIETSVDPNVDPSVQQHDHAHGHVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.3
4 0.33
5 0.32
6 0.35
7 0.36
8 0.42
9 0.4
10 0.45
11 0.44
12 0.47
13 0.54
14 0.59
15 0.59
16 0.56
17 0.56
18 0.52
19 0.55
20 0.51
21 0.44
22 0.34
23 0.31
24 0.27
25 0.24
26 0.2
27 0.12
28 0.08
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.12
39 0.12
40 0.12
41 0.11
42 0.11
43 0.17
44 0.19
45 0.2
46 0.16
47 0.17
48 0.17
49 0.18
50 0.23
51 0.2
52 0.18
53 0.17
54 0.17
55 0.18
56 0.19
57 0.18
58 0.16
59 0.13
60 0.13
61 0.12
62 0.12
63 0.11
64 0.11
65 0.13
66 0.13
67 0.13
68 0.14
69 0.15
70 0.2
71 0.23
72 0.26
73 0.26
74 0.28
75 0.35
76 0.38
77 0.4
78 0.38
79 0.41
80 0.46
81 0.5
82 0.48
83 0.45
84 0.44
85 0.48
86 0.52
87 0.5
88 0.48
89 0.47
90 0.5
91 0.5
92 0.51
93 0.46
94 0.48
95 0.48
96 0.48
97 0.44
98 0.43
99 0.44
100 0.46
101 0.49
102 0.46
103 0.42
104 0.4
105 0.48
106 0.5
107 0.49
108 0.45
109 0.41
110 0.44
111 0.53
112 0.56
113 0.49
114 0.43
115 0.46
116 0.52
117 0.58
118 0.54
119 0.51
120 0.42
121 0.42
122 0.41
123 0.37
124 0.28
125 0.21
126 0.17
127 0.11
128 0.11
129 0.09
130 0.08
131 0.05
132 0.06
133 0.05
134 0.06
135 0.05
136 0.05
137 0.05
138 0.05
139 0.09
140 0.08
141 0.08
142 0.08
143 0.09
144 0.09
145 0.1
146 0.13
147 0.11
148 0.12
149 0.12
150 0.12
151 0.12
152 0.13
153 0.17
154 0.15
155 0.16
156 0.21
157 0.27
158 0.3
159 0.31
160 0.31
161 0.31
162 0.31
163 0.29
164 0.25
165 0.22
166 0.25
167 0.25
168 0.25
169 0.22
170 0.21
171 0.21
172 0.19
173 0.17
174 0.14
175 0.16
176 0.18
177 0.24
178 0.25
179 0.28
180 0.28
181 0.28
182 0.3
183 0.28
184 0.32
185 0.3
186 0.33
187 0.35
188 0.36
189 0.36
190 0.34
191 0.35
192 0.29
193 0.26
194 0.24
195 0.21
196 0.22
197 0.25
198 0.27
199 0.3
200 0.36
201 0.42
202 0.47
203 0.48
204 0.48
205 0.52
206 0.53
207 0.54
208 0.58
209 0.6
210 0.57
211 0.59
212 0.61
213 0.55
214 0.52
215 0.53
216 0.49
217 0.43
218 0.42
219 0.43
220 0.42
221 0.41
222 0.41
223 0.34
224 0.28
225 0.24
226 0.24
227 0.22
228 0.21
229 0.28
230 0.36
231 0.45
232 0.53
233 0.61
234 0.68
235 0.73
236 0.83
237 0.79
238 0.74
239 0.71
240 0.63
241 0.54
242 0.48
243 0.43
244 0.34
245 0.32
246 0.27
247 0.21
248 0.21
249 0.22
250 0.2
251 0.16
252 0.14
253 0.16
254 0.17
255 0.17
256 0.22
257 0.22
258 0.21
259 0.26
260 0.27
261 0.27
262 0.27
263 0.3
264 0.32
265 0.35
266 0.35
267 0.31
268 0.32
269 0.33
270 0.34
271 0.3
272 0.23
273 0.19
274 0.23
275 0.24
276 0.32
277 0.32
278 0.38
279 0.42
280 0.49
281 0.58
282 0.62
283 0.64
284 0.65
285 0.7
286 0.71
287 0.75
288 0.71
289 0.68
290 0.68
291 0.68
292 0.66
293 0.63
294 0.56
295 0.47
296 0.44
297 0.38
298 0.35
299 0.28
300 0.21
301 0.13
302 0.1
303 0.1
304 0.09
305 0.08
306 0.03
307 0.02
308 0.02
309 0.02
310 0.02
311 0.02
312 0.02
313 0.03
314 0.03
315 0.05
316 0.07
317 0.13
318 0.14
319 0.16
320 0.19
321 0.21
322 0.22
323 0.26
324 0.26
325 0.25
326 0.26
327 0.26
328 0.26
329 0.28
330 0.28
331 0.3
332 0.36
333 0.38
334 0.38
335 0.37
336 0.4
337 0.47
338 0.51
339 0.51
340 0.44
341 0.44
342 0.49
343 0.52
344 0.5
345 0.47
346 0.42
347 0.42
348 0.44
349 0.4
350 0.39
351 0.39
352 0.39
353 0.4
354 0.44
355 0.4
356 0.42
357 0.46
358 0.43
359 0.45
360 0.41
361 0.34
362 0.3
363 0.28
364 0.22
365 0.18
366 0.14
367 0.08
368 0.08
369 0.07
370 0.07
371 0.06
372 0.05
373 0.05
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.05
380 0.06
381 0.08
382 0.1
383 0.11
384 0.12
385 0.13
386 0.13
387 0.15
388 0.19
389 0.22
390 0.22
391 0.22
392 0.23
393 0.25
394 0.25
395 0.23
396 0.2
397 0.16
398 0.15
399 0.15
400 0.16
401 0.22
402 0.22
403 0.25
404 0.26
405 0.3
406 0.33