Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0TXP1

Protein Details
Accession Q0TXP1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23SFSVHLPRPLRRRPVRQALLLAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, plas 6, E.R. 4, mito 3, golg 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021047  Mannosyltransferase_CMT1  
KEGG pno:SNOG_15793  -  
Pfam View protein in Pfam  
PF11735  CAP59_mtransfer  
Amino Acid Sequences MSFSVHLPRPLRRRPVRQALLLALVLLALFDASQILHYQSSITAETAPAPRSSERIYIASIHWNNEKILRSHWNDAVVELAKELGKENVFVTVYESGSWDETKSVLSELDDKLEAHNIRRNITLSNTTHVDELSIAEEKKTAGWLDTASGKMLRRIPYLSRLRNWSVDPLLELSRQGQKFDKVLFLNDVVFSTQDVLRLLNTNNGDYAAACSLDFSRPPQFYDTFALQDTEGHRMLMQTWPYFRAKESRQAMLASFPTPVASCWNGMVVMPAEPFVSGKLRFRGIPDSLAALHLEGSECCLIHVDNPLHTAQKRTYVNPQVRVGYSGEAYEAVHPQAILRSFFRTYAAVWENRIRRWTTSPRTAEWKVRSRLHAWRRRTEEKEAGEVCIVDEMQVLADNGWAHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.85
4 0.82
5 0.77
6 0.7
7 0.63
8 0.53
9 0.42
10 0.31
11 0.23
12 0.16
13 0.11
14 0.07
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.08
23 0.08
24 0.08
25 0.09
26 0.1
27 0.13
28 0.13
29 0.13
30 0.12
31 0.12
32 0.16
33 0.19
34 0.2
35 0.18
36 0.2
37 0.21
38 0.24
39 0.27
40 0.27
41 0.27
42 0.27
43 0.28
44 0.27
45 0.28
46 0.34
47 0.33
48 0.32
49 0.32
50 0.32
51 0.31
52 0.34
53 0.36
54 0.27
55 0.3
56 0.35
57 0.37
58 0.41
59 0.43
60 0.42
61 0.38
62 0.36
63 0.36
64 0.28
65 0.23
66 0.17
67 0.16
68 0.12
69 0.12
70 0.13
71 0.12
72 0.11
73 0.12
74 0.12
75 0.15
76 0.15
77 0.14
78 0.17
79 0.16
80 0.16
81 0.15
82 0.16
83 0.12
84 0.14
85 0.14
86 0.11
87 0.09
88 0.09
89 0.1
90 0.09
91 0.09
92 0.08
93 0.09
94 0.13
95 0.13
96 0.15
97 0.15
98 0.15
99 0.15
100 0.2
101 0.21
102 0.2
103 0.25
104 0.24
105 0.25
106 0.27
107 0.28
108 0.23
109 0.25
110 0.3
111 0.26
112 0.28
113 0.28
114 0.26
115 0.25
116 0.23
117 0.2
118 0.13
119 0.12
120 0.1
121 0.11
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.09
129 0.07
130 0.08
131 0.08
132 0.09
133 0.11
134 0.11
135 0.11
136 0.13
137 0.13
138 0.16
139 0.21
140 0.22
141 0.22
142 0.24
143 0.25
144 0.32
145 0.41
146 0.42
147 0.41
148 0.44
149 0.45
150 0.45
151 0.43
152 0.37
153 0.3
154 0.25
155 0.22
156 0.19
157 0.17
158 0.15
159 0.14
160 0.12
161 0.18
162 0.18
163 0.19
164 0.19
165 0.2
166 0.22
167 0.23
168 0.25
169 0.19
170 0.2
171 0.19
172 0.18
173 0.16
174 0.14
175 0.13
176 0.09
177 0.08
178 0.07
179 0.07
180 0.07
181 0.07
182 0.07
183 0.07
184 0.07
185 0.09
186 0.1
187 0.12
188 0.12
189 0.12
190 0.11
191 0.11
192 0.11
193 0.09
194 0.1
195 0.06
196 0.06
197 0.05
198 0.06
199 0.06
200 0.07
201 0.07
202 0.09
203 0.14
204 0.14
205 0.16
206 0.19
207 0.19
208 0.2
209 0.23
210 0.22
211 0.18
212 0.18
213 0.17
214 0.14
215 0.15
216 0.14
217 0.14
218 0.13
219 0.12
220 0.12
221 0.11
222 0.12
223 0.14
224 0.15
225 0.13
226 0.14
227 0.17
228 0.18
229 0.19
230 0.19
231 0.23
232 0.23
233 0.31
234 0.33
235 0.32
236 0.32
237 0.33
238 0.32
239 0.28
240 0.26
241 0.18
242 0.15
243 0.12
244 0.11
245 0.1
246 0.1
247 0.11
248 0.1
249 0.1
250 0.1
251 0.11
252 0.1
253 0.1
254 0.11
255 0.08
256 0.08
257 0.07
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.1
264 0.11
265 0.15
266 0.17
267 0.19
268 0.2
269 0.22
270 0.27
271 0.25
272 0.26
273 0.23
274 0.22
275 0.2
276 0.2
277 0.18
278 0.12
279 0.1
280 0.08
281 0.08
282 0.06
283 0.08
284 0.08
285 0.08
286 0.08
287 0.08
288 0.08
289 0.09
290 0.16
291 0.15
292 0.16
293 0.18
294 0.19
295 0.23
296 0.23
297 0.26
298 0.21
299 0.28
300 0.3
301 0.31
302 0.4
303 0.46
304 0.52
305 0.55
306 0.57
307 0.52
308 0.5
309 0.49
310 0.41
311 0.33
312 0.26
313 0.19
314 0.16
315 0.12
316 0.12
317 0.12
318 0.12
319 0.1
320 0.1
321 0.1
322 0.1
323 0.14
324 0.15
325 0.16
326 0.16
327 0.2
328 0.21
329 0.22
330 0.23
331 0.2
332 0.18
333 0.24
334 0.28
335 0.26
336 0.29
337 0.36
338 0.39
339 0.41
340 0.46
341 0.4
342 0.39
343 0.45
344 0.52
345 0.53
346 0.59
347 0.61
348 0.6
349 0.67
350 0.68
351 0.69
352 0.67
353 0.68
354 0.66
355 0.67
356 0.68
357 0.65
358 0.7
359 0.72
360 0.72
361 0.7
362 0.72
363 0.75
364 0.79
365 0.79
366 0.78
367 0.76
368 0.71
369 0.72
370 0.63
371 0.56
372 0.48
373 0.42
374 0.33
375 0.26
376 0.22
377 0.12
378 0.12
379 0.09
380 0.08
381 0.1
382 0.1
383 0.07
384 0.1