Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y915

Protein Details
Accession C4Y915    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSLRSKPKLRAKSIKRKNEFSKFVDHydrophilic
65-91ISTSGWRQTSRQKLKQKKKNKKNVTKFHydrophilic
NLS Segment(s)
PositionSequence
6-19RSKPKLRAKSIKRK
74-88SRQKLKQKKKNKKNV
Subcellular Location(s) nucl 24, mito_nucl 13.833, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG clu:CLUG_04692  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKPKLRAKSIKRKNEFSKFVDSRNERLAQRMKVNLEKQKEETMEEDPVETNEPKEEKKISTSGWRQTSRQKLKQKKKNKKNVTKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.89
3 0.9
4 0.86
5 0.86
6 0.86
7 0.85
8 0.81
9 0.74
10 0.75
11 0.66
12 0.62
13 0.62
14 0.56
15 0.49
16 0.48
17 0.48
18 0.37
19 0.42
20 0.44
21 0.39
22 0.39
23 0.39
24 0.37
25 0.39
26 0.45
27 0.44
28 0.42
29 0.41
30 0.39
31 0.39
32 0.36
33 0.31
34 0.27
35 0.23
36 0.2
37 0.18
38 0.16
39 0.12
40 0.12
41 0.14
42 0.12
43 0.1
44 0.11
45 0.13
46 0.13
47 0.17
48 0.19
49 0.17
50 0.21
51 0.23
52 0.23
53 0.31
54 0.37
55 0.42
56 0.49
57 0.51
58 0.5
59 0.57
60 0.66
61 0.66
62 0.69
63 0.72
64 0.74
65 0.82
66 0.89
67 0.91
68 0.92
69 0.92
70 0.94
71 0.95