Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4Y3U2

Protein Details
Accession C4Y3U2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
122-141LSEHTGQKQPKPRRSPQTVFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029617  Snt2  
KEGG clu:CLUG_02314  -  
Amino Acid Sequences MAQSRPKRKAACNKNYSDAIIESRFDDIVKPAQANPRNGSRRRGISASPSKSTGSPSAQKSTGKVPYNWQPPPSDADVFSRRLNLTDATVDTKKQVLSCPHQPFEASSFNILDEAEPLAALLSEHTGQKQPKPRRSPQTVFQLKKGDFIYMVSEPPGEPYYIGPDHGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.64
4 0.56
5 0.47
6 0.4
7 0.33
8 0.28
9 0.22
10 0.21
11 0.19
12 0.17
13 0.15
14 0.13
15 0.16
16 0.18
17 0.18
18 0.2
19 0.29
20 0.35
21 0.39
22 0.4
23 0.45
24 0.52
25 0.54
26 0.56
27 0.54
28 0.54
29 0.53
30 0.53
31 0.44
32 0.46
33 0.52
34 0.52
35 0.47
36 0.43
37 0.4
38 0.37
39 0.39
40 0.32
41 0.28
42 0.29
43 0.3
44 0.33
45 0.34
46 0.34
47 0.33
48 0.35
49 0.38
50 0.34
51 0.32
52 0.33
53 0.38
54 0.45
55 0.46
56 0.42
57 0.35
58 0.33
59 0.36
60 0.34
61 0.26
62 0.2
63 0.23
64 0.24
65 0.25
66 0.24
67 0.22
68 0.19
69 0.19
70 0.19
71 0.14
72 0.12
73 0.11
74 0.11
75 0.13
76 0.14
77 0.13
78 0.13
79 0.13
80 0.13
81 0.13
82 0.16
83 0.17
84 0.23
85 0.32
86 0.37
87 0.37
88 0.36
89 0.36
90 0.33
91 0.32
92 0.3
93 0.22
94 0.17
95 0.17
96 0.16
97 0.16
98 0.15
99 0.1
100 0.07
101 0.07
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.07
112 0.08
113 0.14
114 0.16
115 0.23
116 0.33
117 0.41
118 0.5
119 0.59
120 0.67
121 0.73
122 0.8
123 0.8
124 0.78
125 0.79
126 0.8
127 0.74
128 0.71
129 0.69
130 0.59
131 0.59
132 0.51
133 0.42
134 0.32
135 0.29
136 0.28
137 0.21
138 0.22
139 0.17
140 0.17
141 0.15
142 0.18
143 0.18
144 0.14
145 0.13
146 0.13
147 0.19
148 0.2