Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y671

Protein Details
Accession C4Y671   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-32KFMQRAQTKKNEKKNEDAIRKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG clu:CLUG_03655  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MAGLSSNVMNMKFMQRAQTKKNEKKNEDAIRKVKDSSEWVLPNKPLYKRKRNLPSKFQTVGYGCIATLMTKNEEIKEDDKNNDDASNGADKGMDEDFSINIRCLSSRIPMIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.38
4 0.44
5 0.53
6 0.6
7 0.67
8 0.76
9 0.78
10 0.75
11 0.77
12 0.8
13 0.8
14 0.77
15 0.77
16 0.73
17 0.68
18 0.66
19 0.59
20 0.49
21 0.42
22 0.38
23 0.32
24 0.32
25 0.3
26 0.3
27 0.32
28 0.32
29 0.34
30 0.35
31 0.38
32 0.4
33 0.45
34 0.53
35 0.56
36 0.65
37 0.71
38 0.76
39 0.77
40 0.78
41 0.76
42 0.73
43 0.7
44 0.6
45 0.53
46 0.44
47 0.39
48 0.3
49 0.23
50 0.15
51 0.13
52 0.13
53 0.09
54 0.09
55 0.08
56 0.09
57 0.1
58 0.12
59 0.12
60 0.14
61 0.17
62 0.17
63 0.22
64 0.24
65 0.25
66 0.27
67 0.28
68 0.27
69 0.24
70 0.23
71 0.16
72 0.16
73 0.17
74 0.15
75 0.13
76 0.12
77 0.12
78 0.14
79 0.14
80 0.12
81 0.08
82 0.09
83 0.1
84 0.12
85 0.13
86 0.11
87 0.11
88 0.12
89 0.12
90 0.13
91 0.14
92 0.17
93 0.24