Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XXT2

Protein Details
Accession C4XXT2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
282-316TKKAGGRRKLDRSLLKQYRKYKKEGWLRRKLPEDDBasic
NLS Segment(s)
PositionSequence
56-59KKRS
282-311TKKAGGRRKLDRSLLKQYRKYKKEGWLRRK
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
KEGG clu:CLUG_00754  -  
Amino Acid Sequences MSFLTSARPLSKNVSIYSRASKYALTSLRYSSSKKSENDASEDVSQAKKPLGAVLKKRSGSRKDKVQPEASTISATKETTQCYIPFDKLPKPPKEITDMPLDKFYAKVYMRDLPERPEITPSNTFSYKFEIPSQFIRPKRLDQETPNQKSSFEPAHNILDFKIDYDNSGLMKAPDHPLKESITGMFVSNPLMNNIDNDFLWDLYPKGKIFGHAPFGGNPNFDGFREWEKGENAKVKQKELQFEAKLQEMKEFNETLNETKSFYRKTAPEVEKAEPSSSKVETKKAGGRRKLDRSLLKQYRKYKKEGWLRRKLPEDDEDENF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.42
4 0.47
5 0.44
6 0.4
7 0.38
8 0.35
9 0.32
10 0.36
11 0.37
12 0.32
13 0.32
14 0.32
15 0.37
16 0.39
17 0.4
18 0.39
19 0.42
20 0.46
21 0.46
22 0.49
23 0.52
24 0.52
25 0.56
26 0.51
27 0.46
28 0.4
29 0.4
30 0.36
31 0.29
32 0.26
33 0.21
34 0.19
35 0.17
36 0.15
37 0.2
38 0.26
39 0.32
40 0.4
41 0.47
42 0.55
43 0.56
44 0.62
45 0.65
46 0.66
47 0.67
48 0.67
49 0.69
50 0.7
51 0.75
52 0.77
53 0.76
54 0.68
55 0.65
56 0.59
57 0.49
58 0.43
59 0.34
60 0.29
61 0.24
62 0.22
63 0.19
64 0.19
65 0.2
66 0.2
67 0.22
68 0.2
69 0.23
70 0.25
71 0.24
72 0.26
73 0.29
74 0.33
75 0.39
76 0.48
77 0.48
78 0.51
79 0.52
80 0.51
81 0.53
82 0.5
83 0.44
84 0.45
85 0.43
86 0.38
87 0.37
88 0.35
89 0.28
90 0.25
91 0.23
92 0.19
93 0.17
94 0.18
95 0.19
96 0.24
97 0.27
98 0.31
99 0.32
100 0.29
101 0.34
102 0.34
103 0.31
104 0.3
105 0.29
106 0.29
107 0.32
108 0.3
109 0.29
110 0.29
111 0.29
112 0.25
113 0.29
114 0.26
115 0.23
116 0.25
117 0.23
118 0.24
119 0.27
120 0.32
121 0.34
122 0.35
123 0.39
124 0.37
125 0.39
126 0.43
127 0.45
128 0.43
129 0.41
130 0.49
131 0.54
132 0.57
133 0.56
134 0.49
135 0.44
136 0.4
137 0.39
138 0.33
139 0.23
140 0.21
141 0.2
142 0.22
143 0.22
144 0.22
145 0.18
146 0.15
147 0.14
148 0.12
149 0.11
150 0.08
151 0.08
152 0.09
153 0.09
154 0.08
155 0.08
156 0.08
157 0.07
158 0.07
159 0.09
160 0.12
161 0.14
162 0.15
163 0.16
164 0.17
165 0.18
166 0.19
167 0.18
168 0.14
169 0.12
170 0.12
171 0.11
172 0.1
173 0.08
174 0.08
175 0.09
176 0.09
177 0.08
178 0.09
179 0.09
180 0.1
181 0.1
182 0.1
183 0.09
184 0.1
185 0.1
186 0.09
187 0.09
188 0.08
189 0.08
190 0.09
191 0.11
192 0.1
193 0.12
194 0.12
195 0.13
196 0.16
197 0.19
198 0.22
199 0.22
200 0.23
201 0.22
202 0.25
203 0.25
204 0.22
205 0.19
206 0.16
207 0.15
208 0.14
209 0.15
210 0.14
211 0.18
212 0.2
213 0.21
214 0.21
215 0.23
216 0.25
217 0.28
218 0.33
219 0.32
220 0.37
221 0.39
222 0.39
223 0.43
224 0.44
225 0.45
226 0.43
227 0.48
228 0.42
229 0.43
230 0.42
231 0.41
232 0.39
233 0.34
234 0.34
235 0.27
236 0.26
237 0.27
238 0.25
239 0.21
240 0.23
241 0.24
242 0.22
243 0.24
244 0.23
245 0.21
246 0.24
247 0.3
248 0.27
249 0.27
250 0.32
251 0.3
252 0.35
253 0.44
254 0.45
255 0.47
256 0.49
257 0.51
258 0.49
259 0.49
260 0.46
261 0.37
262 0.36
263 0.32
264 0.3
265 0.33
266 0.31
267 0.35
268 0.35
269 0.4
270 0.45
271 0.51
272 0.58
273 0.59
274 0.65
275 0.69
276 0.75
277 0.77
278 0.78
279 0.78
280 0.76
281 0.79
282 0.81
283 0.81
284 0.8
285 0.82
286 0.84
287 0.8
288 0.8
289 0.76
290 0.76
291 0.78
292 0.8
293 0.81
294 0.81
295 0.82
296 0.83
297 0.84
298 0.79
299 0.74
300 0.7
301 0.66