Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y7X1

Protein Details
Accession C4Y7X1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
110-139AEITREPKYQVYKKKQRCRRLKTVDVEPYQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
KEGG clu:CLUG_04299  -  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MFKTIVTGSTRLLSHAAPLRTSAAKAVPDLAPLKFDSNGSSSLYAICKIHNMPYLVSKGDRLVLPYKMKNVKVGDVLKLNNVTSIGSRNFTFNDDNGIPESAFELTATLAEITREPKYQVYKKKQRCRRLKTVDVEPYQTHLVISELKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.26
4 0.22
5 0.24
6 0.26
7 0.26
8 0.26
9 0.22
10 0.19
11 0.19
12 0.19
13 0.2
14 0.17
15 0.19
16 0.21
17 0.19
18 0.17
19 0.17
20 0.18
21 0.16
22 0.16
23 0.15
24 0.15
25 0.16
26 0.16
27 0.16
28 0.14
29 0.15
30 0.15
31 0.15
32 0.13
33 0.12
34 0.12
35 0.13
36 0.16
37 0.18
38 0.18
39 0.18
40 0.21
41 0.23
42 0.21
43 0.21
44 0.18
45 0.14
46 0.15
47 0.14
48 0.13
49 0.15
50 0.18
51 0.22
52 0.22
53 0.28
54 0.31
55 0.32
56 0.34
57 0.32
58 0.3
59 0.31
60 0.31
61 0.27
62 0.25
63 0.25
64 0.21
65 0.2
66 0.18
67 0.13
68 0.12
69 0.1
70 0.08
71 0.11
72 0.1
73 0.11
74 0.11
75 0.12
76 0.13
77 0.15
78 0.16
79 0.13
80 0.17
81 0.16
82 0.17
83 0.17
84 0.17
85 0.14
86 0.13
87 0.14
88 0.08
89 0.08
90 0.07
91 0.06
92 0.05
93 0.05
94 0.06
95 0.05
96 0.05
97 0.05
98 0.07
99 0.09
100 0.11
101 0.12
102 0.13
103 0.18
104 0.27
105 0.35
106 0.44
107 0.53
108 0.62
109 0.72
110 0.81
111 0.86
112 0.88
113 0.91
114 0.9
115 0.9
116 0.9
117 0.88
118 0.85
119 0.86
120 0.84
121 0.77
122 0.72
123 0.62
124 0.56
125 0.48
126 0.4
127 0.3
128 0.21
129 0.19
130 0.17