Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4XWZ1

Protein Details
Accession C4XWZ1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
190-224AYLEKQGLSHSKRQRKKKRKERKTDNQKSEKETVVHydrophilic
NLS Segment(s)
PositionSequence
200-212SKRQRKKKRKERK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG clu:CLUG_00464  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGTIAKGQDLRAIYAGGSETQDRLDSNDVSLFNTCALSALPLYSDGIAEPVVGDSQGRLYLKEKVLENLLQSRKGGESRLKHIRGLDDIVTLTIKRNAKGQIVCPVSGVETSGKSTFCYLRPCGCVFAYKLIVDLRKHFRIRDDEPDIKRSECPACAKEFVFNFDIVILNPEKSEASARFNDRNIAYLEKQGLSHSKRQRKKKRKERKTDNQKSEKETVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.15
5 0.15
6 0.16
7 0.12
8 0.13
9 0.12
10 0.11
11 0.12
12 0.13
13 0.12
14 0.14
15 0.17
16 0.15
17 0.16
18 0.19
19 0.19
20 0.2
21 0.2
22 0.18
23 0.14
24 0.14
25 0.12
26 0.09
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.07
35 0.07
36 0.06
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.05
47 0.09
48 0.09
49 0.1
50 0.12
51 0.18
52 0.21
53 0.25
54 0.25
55 0.23
56 0.26
57 0.26
58 0.26
59 0.28
60 0.28
61 0.25
62 0.24
63 0.24
64 0.22
65 0.22
66 0.24
67 0.22
68 0.24
69 0.3
70 0.4
71 0.4
72 0.4
73 0.4
74 0.38
75 0.34
76 0.32
77 0.25
78 0.17
79 0.15
80 0.14
81 0.13
82 0.11
83 0.1
84 0.13
85 0.13
86 0.13
87 0.17
88 0.18
89 0.23
90 0.24
91 0.25
92 0.28
93 0.29
94 0.28
95 0.25
96 0.23
97 0.18
98 0.17
99 0.15
100 0.08
101 0.06
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.12
108 0.14
109 0.18
110 0.18
111 0.21
112 0.24
113 0.25
114 0.25
115 0.24
116 0.23
117 0.2
118 0.21
119 0.19
120 0.16
121 0.17
122 0.17
123 0.2
124 0.18
125 0.24
126 0.26
127 0.32
128 0.33
129 0.33
130 0.36
131 0.39
132 0.43
133 0.46
134 0.47
135 0.49
136 0.5
137 0.54
138 0.5
139 0.44
140 0.41
141 0.36
142 0.3
143 0.26
144 0.29
145 0.27
146 0.29
147 0.3
148 0.3
149 0.31
150 0.29
151 0.29
152 0.25
153 0.23
154 0.19
155 0.17
156 0.17
157 0.12
158 0.14
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.1
165 0.14
166 0.13
167 0.18
168 0.24
169 0.29
170 0.33
171 0.34
172 0.38
173 0.34
174 0.35
175 0.32
176 0.32
177 0.28
178 0.28
179 0.3
180 0.26
181 0.26
182 0.26
183 0.32
184 0.31
185 0.39
186 0.45
187 0.52
188 0.61
189 0.71
190 0.8
191 0.83
192 0.9
193 0.91
194 0.93
195 0.94
196 0.96
197 0.96
198 0.96
199 0.97
200 0.97
201 0.97
202 0.96
203 0.91
204 0.87
205 0.81