Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4Y318

Protein Details
Accession C4Y318   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
75-98LGCTTRKPGKMRRKNKSTNLPTMGHydrophilic
NLS Segment(s)
PositionSequence
81-89KPGKMRRKN
Subcellular Location(s) mito 20.5, mito_nucl 12.833, nucl 4, cyto_nucl 3.333
Family & Domain DBs
KEGG clu:CLUG_02931  -  
Amino Acid Sequences MAWRSSTSATPMHLERMVVRQKLRHRSISSESKIWWANRMAQRMTPKKLGAIFEASGLRSAKCWAYRSRRAFRELGCTTRKPGKMRRKNKSTNLPTMGNDGSGHEGRENSTLRAFSSRIASARFRSGSRSEPVRSAESSACWLRESEDVVKDSTLSTPTESKVLEMVEVWFKMSLTLDFKSLSWSAITRSSRSADSWLPSILASSSRSLSSMVFPYPTGSPGFWSARYLHVRPFRAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.3
4 0.36
5 0.37
6 0.38
7 0.41
8 0.49
9 0.59
10 0.63
11 0.63
12 0.59
13 0.61
14 0.67
15 0.7
16 0.66
17 0.59
18 0.54
19 0.5
20 0.52
21 0.46
22 0.42
23 0.35
24 0.39
25 0.41
26 0.46
27 0.42
28 0.42
29 0.52
30 0.54
31 0.57
32 0.53
33 0.48
34 0.45
35 0.47
36 0.44
37 0.37
38 0.33
39 0.28
40 0.26
41 0.26
42 0.22
43 0.21
44 0.2
45 0.17
46 0.13
47 0.15
48 0.16
49 0.18
50 0.22
51 0.28
52 0.37
53 0.47
54 0.55
55 0.63
56 0.64
57 0.65
58 0.65
59 0.58
60 0.59
61 0.52
62 0.49
63 0.46
64 0.42
65 0.41
66 0.45
67 0.48
68 0.44
69 0.51
70 0.56
71 0.61
72 0.71
73 0.77
74 0.79
75 0.84
76 0.87
77 0.88
78 0.84
79 0.82
80 0.77
81 0.68
82 0.58
83 0.53
84 0.44
85 0.33
86 0.26
87 0.18
88 0.16
89 0.14
90 0.14
91 0.1
92 0.1
93 0.1
94 0.14
95 0.15
96 0.12
97 0.13
98 0.13
99 0.13
100 0.15
101 0.14
102 0.11
103 0.13
104 0.13
105 0.13
106 0.15
107 0.17
108 0.16
109 0.2
110 0.2
111 0.18
112 0.2
113 0.22
114 0.23
115 0.25
116 0.28
117 0.26
118 0.27
119 0.29
120 0.28
121 0.26
122 0.25
123 0.22
124 0.18
125 0.2
126 0.19
127 0.16
128 0.14
129 0.14
130 0.13
131 0.14
132 0.16
133 0.16
134 0.18
135 0.18
136 0.18
137 0.18
138 0.17
139 0.16
140 0.14
141 0.12
142 0.09
143 0.1
144 0.11
145 0.12
146 0.14
147 0.14
148 0.13
149 0.13
150 0.13
151 0.11
152 0.1
153 0.11
154 0.11
155 0.11
156 0.11
157 0.1
158 0.1
159 0.1
160 0.11
161 0.11
162 0.12
163 0.13
164 0.13
165 0.14
166 0.14
167 0.17
168 0.17
169 0.15
170 0.13
171 0.13
172 0.14
173 0.21
174 0.23
175 0.21
176 0.24
177 0.26
178 0.26
179 0.27
180 0.29
181 0.25
182 0.26
183 0.26
184 0.23
185 0.21
186 0.2
187 0.19
188 0.15
189 0.14
190 0.13
191 0.13
192 0.14
193 0.14
194 0.15
195 0.15
196 0.15
197 0.16
198 0.17
199 0.17
200 0.16
201 0.16
202 0.18
203 0.18
204 0.19
205 0.18
206 0.15
207 0.16
208 0.21
209 0.24
210 0.23
211 0.25
212 0.25
213 0.31
214 0.38
215 0.37
216 0.4
217 0.45